DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and NimB2

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster

Alignment Length:204 Identity:50/205 (24%)
Similarity:73/205 (36%) Gaps:69/205 (34%)


  Fly    26 AITNGHCQKNISVKYQVPVAKTRMAGAG-PPNASHPIDLDSYVVYEERVRWDNIQVCCPGY--RT 87
            |:.:|.|.|.:.....:..::.:..|.| .|:.|                  .|||||.||  ..
  Fly   129 AMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMS------------------RIQVCCDGYERNP 175

  Fly    88 ILFGFCEPVCQEAC--------------PAH------------------SYCAEPDRCHCQRGY- 119
            .::..|||:|.:.|              |.|                  ..|.|.:.|.|:.|| 
  Fly   176 HIYRRCEPICADDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYS 240

  Fly   120 -EPSHHHTTGHQLICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWFSLSLRCERV--QCGHEQ 181
             ||.      .:..|:|.|:.|| ....|||.|:|.|..|::.|:..     .||.|  .|.:.:
  Fly   241 LEPE------TRKYCQPECKPGC-SFGRCVAPNKCACLDGYRLAADG-----SCEPVCDSCENGK 293

  Fly   182 RFDPGRRAC 190
            ...||...|
  Fly   294 CTAPGHCNC 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 36/145 (25%)
NimB2NP_723857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24047
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.