DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and dsl-3

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_500108.1 Gene:dsl-3 WormBaseID:WBGene00001105 Length:263 Species:Caenorhabditis elegans

Alignment Length:139 Identity:32/140 (23%)
Similarity:51/140 (36%) Gaps:29/140 (21%)


  Fly     7 YPMLVLVLMTIHLVEVSSLAITNGHCQKN-----ISVKYQVPVAKTRMAGAGPPNASHPIDLDSY 66
            |.:.:.|:....| ::.:..||.....||     ::|.:  |....||. .|.....|....|.:
 Worm    73 YQITIFVINQDRL-DIDNATITTSFVPKNGQISPLTVMF--PFTGIRMR-VGCDEQWHGEKCDVF 133

  Fly    67 VVYEERVRWDNI-----QVCCP-GYRTILFGFCE-PVCQEACPAHSYCA----------EPDRCH 114
            ...|...|...:     |:.|| |.|.:   .|. |:.::.|...:..|          |..:|.
 Worm   134 CCSETASRVGKVCNSHGQLGCPQGKRGL---DCALPISKKWCKCQNNGACISSFGKNLHEKMQCE 195

  Fly   115 CQRGYEPSH 123
            ||.|:..||
 Worm   196 CQLGFRGSH 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 12/51 (24%)
dsl-3NP_500108.1 DSL 101..163 CDD:302925 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.