DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NPHS1 and hbs

Sequence 1:NP_004637.1 Gene:NPHS1 HGNCID:7908 Length:1241 Species:Homo sapiens
Sequence 2:NP_001286439.1 Gene:hbs FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster

Alignment Length:1208 Identity:351/1209 (29%)
Similarity:539/1209 (45%) Gaps:101/1209 (8%)


Human    22 AQLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLE 86
            ||:|.|.  .:.|...|.:|.::||....|||.||.....|||.|||..||....|||||||.:.
  Fly    31 AQVAAPP--VQKFHLTPHDLQILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVL 93

Human    87 GDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEA-GTMVTW 150
            .|..:..::|.|:...|.|||||:||||.:...| .:.....|||:..|..:::...| ...|..
  Fly    94 VDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNP-AIRANAKLSIVAAPSSIVIEGYARNARVEV 157

Human   151 VAGQEYVVNCVSGDAKPAPDITILLSGQTISDIS-ANVNEGSQQKLFTVEATARVTPRSSDNRQL 214
            ...|...::|::.:|.||.:|........:|... ..||: :..|.||..:|..:.||:.|:.:.
  Fly   158 EERQNLTLHCIAENANPAAEIVWFQGEVPVSTAPIVTVNQ-TAPKRFTTSSTLHLQPRAEDDYKE 221

Human   215 LVCEASSPAL--EAPIKASFTVNVLFPPGPPVIEWPGLDEGH-VRAGQSLELPCVARGGNPLATL 276
            ..|||...||  :.|::|...::||:|||.|..|  |..:|. :..||.:::.|.:|||||.|.|
  Fly   222 FSCEARHKALPPDVPMRAQVQLSVLYPPGAPFFE--GYSQGETLHRGQEVQIACRSRGGNPPAQL 284

Human   277 QWLKNGQPVSTAWGTEHTQAVARSVLVMTVRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPS 341
            .|.:||..:|:...|  :..::.:|...|...||:||.|.|||.|.::.......:.|.|.:.|.
  Fly   285 TWYRNGVAISSPQRT--SGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPK 347

Human   342 AIIILGSASQTENKNVTLSCVSKSSRPRVLLRWWLGWRQLLPMEETVMDGLHGGHISMSNLTFLA 406
            .:.:.|:.......:|.||||:..|.|:..:.|.:..|.|............||.:|.||::...
  Fly   348 DVYLSGANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGWVSSSNISLTI 412

Human   407 RREDNGLTLTCEAFSEAFTKETFKKSLILNVKYPAQKLWIEGPPEGQKLRAGTRVRLVCLAIGGN 471
            ..:.......|.|.:...|:... .|..:||.||.....:.|..:|..|.:|:.::|.|.:.|||
  Fly   413 DSQSRTFIAVCHALNTELTQNVV-GSHTVNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGN 476

Human   472 PEPSLMWYKDSRTV-TESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQ--- 532
            |.|:|.|||:.:.: ..|:|..              |..:.||.|:...|||.|.:.||...   
  Fly   477 PPPTLQWYKNDKIINAPSKLVD--------------SKITSELSLLVNASDNNAIYKCKVQNAAI 527

Human   533 ---LSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSWDKEGERLEGVAAPP 594
               |.|:..|.|.|||..|.|......|.||....|.|.|.|||||..:||.|:|..:||:....
  Fly   528 DIPLFATKTLGVHFPPETVKISVVPKNLVPGIRAKLICDSSSSNPPAKISWWKDGIPVEGLNLAN 592

Human   595 RRAPFKGSAAARSVLLQVSSRDHGQRVTCRAHSAELRETVSSFYRLNVLYRPEFLGEQVLVVTAV 659
            |...:.||.:...:.:.::....|...||::|:..|:.:|.....|::||.|:|...|......|
  Fly   593 RPGLWGGSVSTLEMYVNITQDLDGIVYTCQSHNEVLQRSVHETISLDILYPPKFETPQSTTFVGV 657

Human   660 EQGEALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSG-ALHLWNVTRADDGLYQLHCQN 723
            |.....:.:..|.||....:.||..|..:|.......|::|.| .|::..::|.|.|:|.....|
  Fly   658 EGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALN 722

Human   724 SEGTAEARLRLDVHYAPTIRALQDPTEVNVGGSVDIVCTVDANPILPGMFNWERLGEDEEDQSLD 788
            |:|||...:::.|.|||||.|:.:......|....:.|.:.|.|:......|.|.|.|...:::.
  Fly   723 SQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRWSRDGYDLATRTIS 787

Human   789 DMEKISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAG 853
            ..|    ..|..|:|...:.:..|.:.|||||....||.:.:.|||:.||:::|....|:.||. 
  Fly   788 SFE----NGTALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEIDHSPGFTRYAAR- 847

Human   854 DSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQGGV--HSSLLTIANVSAAQDYA 916
             ....|.|.||:...|...|.|.::|..|.:|.....:....|...  ..|.|.|.|.| ..||.
  Fly   848 -LGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTS-PDDYG 910

Human   917 LFTCTATNALGSDQTNIQLVSISRPDPPSGLKVVSLTPHSVGLEWKPGFDGGLPQRFCIRYEALG 981
            .:.|...|:||...|.::....||||.|..|:|.:::...|.|.|.||||||:...|.:|.:..|
  Fly   911 QYECVVRNSLGQASTTLEFSKPSRPDAPLQLRVGNVSDTGVDLNWTPGFDGGMQTYFRLRLKQHG 975

Human   982 TPGFHYVDVVPPQATTFTLTGLQPSTRYRVWLLASNALGDSGL-------ADKGTQLPITTPGLH 1039
            ...:.|||..|.. ...:|.||:|...|...::|:|..|.|..       ..||:|     |  |
  Fly   976 EDKYKYVDAKPGH-QNISLDGLKPGATYYFSVMAANEAGGSKFMPDIKLTLSKGSQ-----P--H 1032

Human  1040 QPSGEPEDQLPTEPPSGPSGLPLLPVLFALGGLLLLSNASCVGGVLWQRRLRRLAEGISEKTEAG 1104
            ......:|:||.....|.:...:         :||:.||:.|...:.:|:.:..:|......:..
  Fly  1033 SAEYTEKDELPNVMIIGITSAAM---------VLLVLNAALVAWFVIRRQNKSQSEAEPSNDDVY 1088

Human  1105 SEEDRVRNEYEESQWTGERDTQ----SST--------VSTTEAEPYYRSLRDFSPQLP------- 1150
            |::|. ::.|:......:.|.|    :||        :.:|...|.|:.....:|..|       
  Fly  1089 SKDDS-QSVYKLPITALQADVQKKAAASTYLVENVDIIQSTAYPPKYQESSMCTPPYPLCNPDFT 1152

Human  1151 ---PTQEEVSYSRGFTG---------EDEDMAFPGHLY 1176
               |..:..|.....||         :|:.|.....||
  Fly  1153 RTLPNPKRHSQRNSATGMIEGMQMRSKDDHMLISNGLY 1190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NPHS1NP_004637.1 V-set 38..119 CDD:284989 37/81 (46%)
IG_like 38..113 CDD:214653 35/75 (47%)
C2-set_2 141..228 CDD:285423 24/91 (26%)
Ig 240..321 CDD:299845 31/82 (38%)
IG_like 254..336 CDD:214653 27/83 (33%)
Ig 345..424 CDD:299845 18/79 (23%)
Ig 445..530 CDD:299845 27/86 (31%)
I-set 446..541 CDD:254352 30/102 (29%)
Ig 549..632 CDD:299845 26/83 (31%)
IG_like 558..642 CDD:214653 26/84 (31%)
I-set 646..736 CDD:254352 25/91 (27%)
Ig 662..736 CDD:299845 20/75 (27%)
Ig_3 739..820 CDD:290638 22/81 (27%)
IG_like 748..821 CDD:214653 18/73 (25%)
Ig8_hNephrin_like 834..942 CDD:143250 33/110 (30%)
IG_like 845..935 CDD:214653 26/92 (28%)
fn3 942..1023 CDD:278470 29/81 (36%)
Binds to NPHS2 1160..1241 6/27 (22%)
hbsNP_001286439.1 Ig 44..122 CDD:299845 37/78 (47%)
IG_like 45..137 CDD:214653 40/93 (43%)
Ig 153..231 CDD:299845 21/79 (27%)
IG_like 258..342 CDD:214653 28/86 (33%)
Ig 266..327 CDD:299845 25/63 (40%)
IG_like 357..>414 CDD:214653 15/57 (26%)
Ig 360..427 CDD:299845 17/67 (25%)
Ig <468..526 CDD:299845 23/72 (32%)
I-set 547..633 CDD:254352 27/86 (31%)
Ig 556..631 CDD:299845 24/75 (32%)
I-set 644..735 CDD:254352 25/91 (27%)
IGc2 668..725 CDD:197706 17/57 (30%)
IG_like 751..829 CDD:214653 22/82 (27%)
IGc2 753..815 CDD:197706 17/66 (26%)
Ig 852..928 CDD:143165 23/77 (30%)
FN3 935..1017 CDD:238020 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 496 1.000 Inparanoid score I1377
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D141865at33208
OrthoFinder 1 1.000 FOG0005332
OrthoInspector 1 1.000 T608452
orthoMCL 1 0.900 OOG5_134110
Panther 1 1.100 O PTHR11640
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.