DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NPHS1 and side-III

Sequence 1:NP_004637.1 Gene:NPHS1 HGNCID:7908 Length:1241 Species:Homo sapiens
Sequence 2:NP_001036681.1 Gene:side-III FlyBaseID:FBgn0083949 Length:1689 Species:Drosophila melanogaster

Alignment Length:1303 Identity:243/1304 (19%)
Similarity:407/1304 (31%) Gaps:434/1304 (33%)


Human    61 AVQWAKDGLLLGPDPRIPGFPRYRLEG-DPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVS 124
            |:.|: |....||       ..|.:.| .||:    |.::...|.|:..|.|:|....      |
  Fly   109 ALYWS-DTNSFGP-------RAYFVTGQQPAK----LSVDNIQLDDEGVYRCRVDFQN------S 155

Human   125 P----RVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISA 185
            |    |:.|:::|||..:|:...:|..|....|                                
  Fly   156 PTRNHRINLTVIVPPHQILVYDASGRDVAGAVG-------------------------------- 188

Human   186 NVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGL 250
                                                                     |::|    
  Fly   189 ---------------------------------------------------------PLLE---- 192

Human   251 DEGHVRAGQSLELPCVARGGNPLATLQWLKNGQPVSTAWGTE----------HTQAVARSVLVMT 305
                   |.::.|.|..|||.|..|:.|:...:.:....|..          ....::||.|..|
  Fly   193 -------GDNIVLTCEVRGGRPEPTVTWMNGTRTLEAGSGVSMGRHVTVNRLEVAQISRSALNNT 250

Human   306 VRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPSAIIILGS----ASQTENKNVTLSCVSKSS 366
            .|         |:|.|:......|..|.:::...|:::.:...    ||.|:   ..|:|:...|
  Fly   251 YR---------CQASNTKLVAPVERSIRIEMLLKPTSVNLTNKLKVFASNTQ---YNLTCIVAGS 303

Human   367 RPRVLLRWWLGWRQLLPMEETVMDGLHGGHISMSNLTFLARREDNGLTLTCEAFSEAFTKETFKK 431
            .|...::|....|   |.:..::.........:|.|||..:.||:|..|.||..:........:.
  Fly   304 VPDTEIKWTQNNR---PFKRGLLSTSQSNGRVISTLTFYPQPEDDGTMLKCEGSNPRLQNSAIED 365

Human   432 SLILNVKYPAQ-KLWIEGPPEGQKLRAGTRVRLVCLAIGGNP-EPSLMWYKDSRTVTESRLPQES 494
            ||::||.||.| .|.:........::.|..|...| .|..|| |..:||..|.:.||::      
  Fly   366 SLMMNVIYPPQVTLSLGSTLRPDDIKEGDDVYFEC-HIKSNPKEHRIMWSHDGQPVTQN------ 423

Human   495 RRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQ-----LSASTQLAVQFPP----TNVTI 550
              |..|.:     ..:|.|||......:...:.|.|..     .||...|.:::.|    :::|:
  Fly   424 --VSWGII-----ISTRSLVLQRVGRIHSGFYACSAANDRGETQSAPVNLRIRYAPVCSSSSITV 481

Human   551 LANASALRPGDALNLTCVSVSSNPP-VNLSW--DKEGERLE---GVAAPPRRAPFKGSAAARSVL 609
            :  .::|.  :.:.:.| .|:|:|| ::..|  ...||..|   |..|..:......::..|..:
  Fly   482 I--GASLE--EDVPIPC-RVNSDPPEIDFEWTFSTSGEHFEVPSGHYATIQDPTMTTTSDVRRTV 541

Human   610 LQVSSRDHGQRVTCRAHSAELRETVSSFYRLNVLYRPEFLGEQVLVVTAVEQGEALLPVSVSANP 674
            ::.:          ..|.....||||     .::|.|:  ||:.....|.....|   :...::|
  Fly   542 VESN----------ETHFESYVETVS-----ELIYTPK--GERDYGTLACYGRNA---IGKQSDP 586

Human   675 APEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGLYQLHCQNSEGTAEARLRLDVHYA 739
            ..         :::.||..|       |||.  |.|                     ||   .|.
  Fly   587 CV---------FQVVPAAKP-------GALR--NCT---------------------LR---PYV 609

Human   740 PTIRALQDPTEVNVGGSVDIVCTVDANPILPGMFNWERLGEDEEDQSLDDMEKISRGPTGRLRIH 804
            .|..:|....:.          |:.||.|||..:.       ..:.:...||.:        |..
  Fly   610 VTSASLNSSNQT----------TMHANQILPTQYG-------RHESNYPHMEYV--------RER 649

Human   805 HAKLAQAGAYQCIVDNGVAPPARR----------------------------LLRLVVR--FAP- 838
            |   ..:|..    :||.||.|.|                            |.||..|  |.| 
  Fly   650 H---NSSGGN----NNGTAPAAGRNNVANKNMRGRTSAGQAKSNNKQLTQQQLQRLKKRTSFTPS 707

Human   839 -----------------------QVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGV 880
                                   |..|....||  :.||:        :..|.|   ...:|..:
  Fly   708 QTLAAIERQRQRKQLSQQQQQLQQQHHQATATK--SGGDN--------KPDGSP---AKSSKQRM 759

Human   881 PLDLQDPRYTEHTYHQGGVHSSLLTIANVSAAQDYALFTCTATNALG-----------SDQTNIQ 934
            ....:||:..:...||......|....:::::|.....:..:|:.||           |..:||.
  Fly   760 RRASRDPQIQQQQQHQQQQQHQLHAATSITSSQRKQAESNLSTSHLGKGSSSSSRSRRSSSSNIN 824

Human   935 LVSISRPDPPSGL----KVVSLTPHSVGLEWKPGFDGGLPQRFCIRYEALGT-----PGFHYVDV 990
            ..|.:...|....    |.:....|...|:...|............|.||.:     ......|:
  Fly   825 SKSNNGKQPAKYFNKRQKNMHKQKHQQKLKQLKGTTNEHNSNIIHHYAALSSSLRRRKRLAANDI 889

Human   991 VPPQATTFTLTGLQPSTRYRVWLLASNA----------------LGDSGLADKGTQLPITTPGLH 1039
            :...|...|...|..........||:.|                ..|||..:|.::..:|   :.
  Fly   890 LATVAAASTSASLSSPPASSAASLAATATAAVEIEQDVSAVDAPAADSGSNNKRSRKSLT---IL 951

Human  1040 QPSGEPEDQLPTEPPSGPSGLPLLPVLFALGGLLLLSNASCVGGVLWQRRLRRLAEGISEKTEAG 1104
            ....:.::|....||:.|. :...||....|..:..:.|:...|.        :|.|:.:|..: 
  Fly   952 DKQKQQQEQQQLLPPNAPQ-ISNQPVAAISGNNVKETAATSAHGA--------VAAGVKDKAPS- 1006

Human  1105 SEEDRVRNEYEESQWTGERDTQSSTVSTTEAEPYYRSLRDFSPQLPPTQEEVSYSRGFTGEDEDM 1169
            |:||...|:.:..   |:.|.........|.:          .:.....||.....|....|:| 
  Fly  1007 SKEDSTDNDNDSD---GDEDDDDDDDDGAEID----------AETETNDEEEDEDEGGEAHDDD- 1057

Human  1170 AFPGHLYDEVERTYPPSGAWGPLYDEVQMGPWDLHWPEDTYQDPRG---------IYDQVAGDLD 1225
               ..|.::|.:....:       |.:..||.||. ..:|.::..|         :.:|:  ||:
  Fly  1058 ---ADLDEDVAQLATDA-------DYLADGPGDLQ-EYETVEEVDGQAKHVHMLSLEEQL--DLE 1109

Human  1226 TLE 1228
            :||
  Fly  1110 SLE 1112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NPHS1NP_004637.1 V-set 38..119 CDD:284989 15/59 (25%)
IG_like 38..113 CDD:214653 14/53 (26%)
C2-set_2 141..228 CDD:285423 3/87 (3%)
Ig 240..321 CDD:299845 19/91 (21%)
IG_like 254..336 CDD:214653 20/92 (22%)
Ig 345..424 CDD:299845 20/83 (24%)
Ig 445..530 CDD:299845 19/86 (22%)
I-set 446..541 CDD:254352 23/101 (23%)
Ig 549..632 CDD:299845 15/89 (17%)
IG_like 558..642 CDD:214653 17/90 (19%)
I-set 646..736 CDD:254352 16/90 (18%)
Ig 662..736 CDD:299845 12/74 (16%)
Ig_3 739..820 CDD:290638 13/81 (16%)
IG_like 748..821 CDD:214653 12/73 (16%)
Ig8_hNephrin_like 834..942 CDD:143250 25/145 (17%)
IG_like 845..935 CDD:214653 19/101 (19%)
fn3 942..1023 CDD:278470 17/106 (16%)
Binds to NPHS2 1160..1241 17/79 (22%)
side-IIINP_001036681.1 IG_like 59..166 CDD:214653 19/75 (25%)
V-set 59..166 CDD:284989 19/75 (25%)
ig 190..268 CDD:278476 20/98 (20%)
IG_like 192..259 CDD:214653 19/87 (22%)
Ig 296..361 CDD:299845 17/68 (25%)
IG_like 391..468 CDD:214653 23/91 (25%)
IGc2 392..454 CDD:197706 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.