DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NPHS1 and side

Sequence 1:NP_004637.1 Gene:NPHS1 HGNCID:7908 Length:1241 Species:Homo sapiens
Sequence 2:NP_001247334.1 Gene:side FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster

Alignment Length:871 Identity:197/872 (23%)
Similarity:302/872 (35%) Gaps:229/872 (26%)


Human   407 RREDNGLT----------LTC----EAFSEAFTKETFKKSLILNVKYPAQKLWIEGPPEGQKLRA 457
            |..|||.|          |||    ::.|.....:.|:|::      ||:.:|         ...
  Fly    55 RCPDNGKTIWAVGFTLVLLTCLQQLKSVSADEESQDFQKNI------PARLVW---------AAL 104

Human   458 GTRVRLVCLAIGGNPEPS---LMWYKDSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTG- 518
            |..|.|.|.......:.|   |:|:||:..:....|......|.|.......|...:.|....| 
  Fly   105 GKTVELPCDLTPPTSQDSVKLLLWFKDTTGIPLYSLDSRGGNVKLAPHAAIASDLGQRLFFSIGD 169

Human   519 -PSDNQAK-----------FTCKAGQLSASTQ-----LAVQFPPTNVTIL--------ANASALR 558
             |.|::.:           :.|:....::.|:     |.:..||....|.        ..|...|
  Fly   170 NPKDSRLQINDVKPEDGGVYRCRVDFFNSPTRNFRHNLTLVVPPEEPRIFDAQGKEISQMAGPFR 234

Human   559 PGDALNLTCVSVSSNPPVNLSWDKEGERLEGVAAPPRRAPFKGSAA-ARSVLLQVSSRD-HGQRV 621
            .|..|.|.|......||..::|.::...|.|.:   ..:..:|:.. ...:|:..::|| :|.|:
  Fly   235 EGYELFLCCQVRGGRPPPKVTWWRDDTELIGTS---HTSVEEGATVMVNQLLIGTTTRDFYGIRI 296

Human   622 TCRAHSAELRETVSSFYRLNVLYRPEFLGEQVLVVTAVEQGEALLPVSV-----SANPAPEAFNW 681
            .|||....|.:.|.....:.|..:|    .:|.:.|..|...|..|:.:     .:.||.: ..|
  Fly   297 ECRAQGTRLVDPVRKDVTVQVYLKP----VRVKIATPNELLTAGQPMPIRCESWGSYPAAK-ITW 356

Human   682 TFRGYRLSPAGGPRHRILSSG----ALHLWNVTRADDGLYQLHCQN-----SEGTAEARLRLDVH 737
            ...|..:..|....|.....|    ::....||..:|.. :|.|:.     |.|..|.:..:.|.
  Fly   357 LLDGEPIRNAEVTVHSDKEDGNITTSILTLKVTSENDNA-ELTCRATNPWFSGGAIEDKRIIRVA 420

Human   738 YAPTIR---ALQDPTEVNV---GGSVDIVCTVDANPILPGMFNW-----ERLGEDEEDQSLDDME 791
            |.||:.   |.:||:.:..   |.:|...|..||.|.:.. ::|     ...||..|...|..:|
  Fly   421 YPPTVSVHLANEDPSRLVTRAEGQNVTFKCRADARPPVTS-YSWFKNGMRMSGESTEIMHLTQLE 484

Human   792 KISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAGDST 856
            :.|                ||||.|...|.........|.|.|:|:|:.:..|..|.:.|.  |.
  Fly   485 RES----------------AGAYACGATNTEGETRSSSLTLKVQFSPRCKSGTEQTSIGAV--SL 531

Human   857 SSATLHCRARGVP--NIVFTWTKNGV----PL---DLQDPRYTEHTYHQGGVHSSLLTIANVSAA 912
            .|..:.|.....|  ::.|:||.|..    |:   .:|.........:.....|.|:|:|     
  Fly   532 HSILVKCEVDADPPDSVRFSWTYNNTRNVSPVLNSRIQSNGLASTVTYLPQTDSELITLA----- 591

Human   913 QDYALFTCTATNALGSDQTNIQLVSISRPDPPSGLKVVSLTPHSVGLE--WKPGFDGGLPQRFCI 975
                   |.|:||:|. ||...||.|...:.|...|...|...:| ||  ...|.||||.|.|.:
  Fly   592 -------CWASNAVGR-QTTPCLVHILPANTPEAPKACELRNDTV-LEVVCVAGSDGGLSQYFML 647

Human   976 RY-----------------------EALGTPGFHYVDVVPPQATT------------FTLTGLQP 1005
            ..                       ||:|. |.:.:..:..|||:            |.|..|:|
  Fly   648 EVVGGDPLYSGDPGGSAGQGRGQFSEAIGL-GDNEISTLNDQATSAPIFRMQENSPQFRLNNLEP 711

Human  1006 STRYRVWLLASNALGDSGLADKGTQLPITTP--------GLHQPSGEPEDQLPTEPP-------- 1054
            ...|:..:.|.||.|.|       :.|:...        |.:..|...||..|.|..        
  Fly   712 GREYQFLVYAVNAKGRS-------EPPVVIENVRVAAQLGPYDESILSEDPTPAETTHHGGGGVG 769

Human  1055 ---------------SGP---SGLPLLPVLFALGGLLLLSNASCVGGVLWQRRLRRLAEGISE-- 1099
                           |||   |.|.:|..:..:|.:::.|  ..|.|::...|.|.......|  
  Fly   770 GSGSSSGLGTGASTGSGPEKQSTLLILAAVVVIGAVVVTS--IIVAGIVVVCRHRPRPPEPQEVR 832

Human  1100 ------KTEAGS---EEDRVRNEYEE 1116
                  :.:..|   |||.: ||.||
  Fly   833 KSMRPARNDVPSMYIEEDEL-NELEE 857

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NPHS1NP_004637.1 V-set 38..119 CDD:284989
IG_like 38..113 CDD:214653
C2-set_2 141..228 CDD:285423
Ig 240..321 CDD:299845
IG_like 254..336 CDD:214653
Ig 345..424 CDD:299845 9/31 (29%)
Ig 445..530 CDD:299845 19/101 (19%)
I-set 446..541 CDD:254352 20/116 (17%)
Ig 549..632 CDD:299845 22/93 (24%)
IG_like 558..642 CDD:214653 21/86 (24%)
I-set 646..736 CDD:254352 21/104 (20%)
Ig 662..736 CDD:299845 17/88 (19%)
Ig_3 739..820 CDD:290638 23/92 (25%)
IG_like 748..821 CDD:214653 20/81 (25%)
Ig8_hNephrin_like 834..942 CDD:143250 30/117 (26%)
IG_like 845..935 CDD:214653 23/99 (23%)
fn3 942..1023 CDD:278470 30/118 (25%)
Binds to NPHS2 1160..1241
sideNP_001247334.1 V-set 95..211 CDD:284989 23/131 (18%)
IG_like 100..211 CDD:214653 21/120 (18%)
Ig 235..301 CDD:299845 18/69 (26%)
Ig 326..408 CDD:299845 17/84 (20%)
IG_like 329..407 CDD:214653 15/80 (19%)
IG_like 435..511 CDD:214653 21/93 (23%)
Ig_2 442..511 CDD:290606 21/86 (24%)
FN3 <700..735 CDD:238020 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.