DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp70Bc and AT3G09440

Sequence 1:NP_650209.1 Gene:Hsp70Bc FlyBaseID:FBgn0013279 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001189847.1 Gene:AT3G09440 AraportID:AT3G09440 Length:649 Species:Arabidopsis thaliana

Alignment Length:651 Identity:441/652 (68%)
Similarity:518/652 (79%) Gaps:20/652 (3%)


  Fly     2 PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFD 66
            ||||||||||||||||:||.:||||||||||||||||||||||||||||.|||||||||.|||||
plant     8 PAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPINTVFD 72

  Fly    67 AKRLIGRKYDDPKIAEDMKHWPFKVVS-DGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEA 130
            |||||||::.|..:..|:|.|||.:.| ...||.|.|.||||.|.|:.||||||:|.||:|.|||
plant    73 AKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEISSMILIKMREIAEA 137

  Fly   131 YLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVL 193
            |||.:|.:||:||||||||||||||||||.||||||:||||||||||:||||||...  ||:|||
plant   138 YLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVL 202

  Fly   194 IFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRAL 258
            ||||||||||||:|||:|| :|||::|||||||||||||||:|.|..:|||||.|||:..|||||
plant   203 IFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRAL 266

  Fly   259 RRLRTAAERAKRTLSSSTEATIEIDALFEGQDFYTKVSRARFEELCADLFRNTLQPVEKALNDAK 323
            ||||||.|||||||||:.:.|||||:||:|.|||..::|||||||..||||..::||||.|.|||
plant   267 RRLRTACERAKRTLSSTAQTTIEIDSLFDGIDFYAPITRARFEELNIDLFRKCMEPVEKCLRDAK 331

  Fly   324 MDKGQIHDIVLVGGSTRIPKVQSLLQEFFHGKNLNLSINPDEAVAYGAAVQAAILSGDQSGKIQD 388
            |||..|.|:|||||||||||||.||.:||:||.|..|||||||||||||||||||||:.:.|:||
plant   332 MDKNSIDDVVLVGGSTRIPKVQQLLVDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQD 396

  Fly   389 VLLVDVAPLSLGIETAGGVMTKLIERNCRIPCKQTKTFSTYSDNQPGVSIQVYEGERAMTKDNNA 453
            :||:||.|||||:||||||||.||:||..||.|:.:.|||||||||||.|||||||||.|||||.
plant   397 LLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNL 461

  Fly   454 LGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSAKEMSTGKAKNITIKNDKGRLSQAEIDRMVN 518
            ||.|:||||||||||||||.|.||:||||||||||::.:||:...|||.|||||||:.||::||.
plant   462 LGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQ 526

  Fly   519 EAEKYADEDEKHRQRITSRNALESYVFNVKQSVEQAPAG-KLDEADKNSVLDKCNETIRWLDSNT 582
            |||||..|||:|::::.::||||:|.:|::.::.....| ||...||..:.|.....|.||::|.
plant   527 EAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQ 591

  Fly   583 TAEKEEFDHKMEELTRHCSPIMTKMHQQGAGAAGGPGANCGQQAGGF-------GGYSGPTVEEV 640
            .||.:||:.||:||...|:||:.||:|  .|.||||.      |||.       .|.:||.:|||
plant   592 LAECDEFEDKMKELESICNPIIAKMYQ--GGEAGGPA------AGGMDEDVPPSAGGAGPKIEEV 648

  Fly   641 D 641
            |
plant   649 D 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp70BcNP_650209.1 PTZ00009 2..641 CDD:240227 440/650 (68%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 286/379 (75%)
AT3G09440NP_001189847.1 PTZ00009 5..649 CDD:240227 440/650 (68%)
HSPA1-2_6-8-like_NBD 9..387 CDD:212675 286/379 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.