DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp70Bc and Hspa2

Sequence 1:NP_650209.1 Gene:Hsp70Bc FlyBaseID:FBgn0013279 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_068635.1 Gene:Hspa2 RGDID:620664 Length:633 Species:Rattus norvegicus

Alignment Length:643 Identity:476/644 (74%)
Similarity:545/644 (85%) Gaps:18/644 (3%)


  Fly     2 PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFD 66
            ||||||||||||||||:|||||||||||||||||||||||||:||||||.|||||||||.||:||
  Rat     6 PAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFD 70

  Fly    67 AKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAY 131
            ||||||||::|..:..|||||||:|||:|||||:.||||||.|.|.||||||||||||||.||||
  Rat    71 AKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAY 135

  Fly   132 LGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKN--LKGERNVLI 194
            ||..:..|||||||||||||||||||||.|.|||||||||||||||:||||||.  ..||:||||
  Rat   136 LGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLI 200

  Fly   195 FDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRALR 259
            |||||||||||||||::| :|||:||||||||||||||||:|:|||||||||:|||:..|.||:|
  Rat   201 FDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVR 264

  Fly   260 RLRTAAERAKRTLSSSTEATIEIDALFEGQDFYTKVSRARFEELCADLFRNTLQPVEKALNDAKM 324
            |||||.|||||||||||:|:||||:|:||.||||.::|||||||.|||||.||:||||||.|||:
  Rat   265 RLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKL 329

  Fly   325 DKGQIHDIVLVGGSTRIPKVQSLLQEFFHGKNLNLSINPDEAVAYGAAVQAAILSGDQSGKIQDV 389
            |||||.:||||||||||||:|.|||:||:||.||.|||||||||||||||||||.||:|..:||:
  Rat   330 DKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDL 394

  Fly   390 LLVDVAPLSLGIETAGGVMTKLIERNCRIPCKQTKTFSTYSDNQPGVSIQVYEGERAMTKDNNAL 454
            ||:||.||||||||||||||.||:||..||.|||:||:||||||..|.:||||||||||||||.|
  Rat   395 LLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLL 459

  Fly   455 GTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSAKEMSTGKAKNITIKNDKGRLSQAEIDRMVNE 519
            |.|||:|||||||||||||||||:||||||||:|.:.||||...|||.|||||||:.:|||||.|
  Rat   460 GKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQE 524

  Fly   520 AEKYADEDEKHRQRITSRNALESYVFNVKQSVE-QAPAGKLDEADKNSVLDKCNETIRWLDSNTT 583
            |:.|..|||.:|.|:.::||:|||.:|:||:|| :...||:.|.|||.:||||.|.|.|||.|..
  Rat   525 ADGYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQM 589

  Fly   584 AEKEEFDHKMEELTRHCSPIMTKMHQQGAGAAGGPGANCGQQAGGFGGYSGPTVEEVD 641
            |||:|::||.:||.|.|:||::|::|      |||        ||.|...|||:||||
  Rat   590 AEKDEYEHKQKELERVCNPIISKLYQ------GGP--------GGGGSSGGPTIEEVD 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp70BcNP_650209.1 PTZ00009 2..641 CDD:240227 475/642 (74%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 309/378 (82%)
Hspa2NP_068635.1 PTZ00009 2..615 CDD:240227 462/610 (76%)
Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 2..389 313/384 (82%)
HSPA1-2_6-8-like_NBD 7..383 CDD:212675 308/377 (82%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 397..512 90/115 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.