DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp70Bc and F44E5.4

Sequence 1:NP_650209.1 Gene:Hsp70Bc FlyBaseID:FBgn0013279 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_496509.1 Gene:F44E5.4 WormBaseID:WBGene00009691 Length:645 Species:Caenorhabditis elegans

Alignment Length:647 Identity:445/648 (69%)
Similarity:532/648 (82%) Gaps:15/648 (2%)


  Fly     3 AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDA 67
            ||||||||||||||:||:|||||:||.:||:||||||||||:|||:||.||:|.|.||.||||||
 Worm     6 AIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDA 70

  Fly    68 KRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYL 132
            ||||||::|:..:..|.|||||.|....|||.|.||.|||.::|.|||||:|||.|||||||.||
 Worm    71 KRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYL 135

  Fly   133 GESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDL 197
            |.::.|||||||||||||||||||||..|||||.:|||||||||||||||||.::.|:|||||||
 Worm   136 GHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDL 200

  Fly   198 GGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLAEEFKRKYKKDLRSNPRALRRLR 262
            ||||||||||:|.|||:|||:||||||||||||||.|::.|...|||||..||:..||||:||||
 Worm   201 GGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLR 265

  Fly   263 TAAERAKRTLSSSTEATIEIDALFEGQDFYTKVSRARFEELCADLFRNTLQPVEKALNDAKMDKG 327
            ||.||||||||||:||.:|:|:||||.|..||::|||||||||||||.||:||||||.|||:||.
 Worm   266 TACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKS 330

  Fly   328 QIHDIVLVGGSTRIPKVQSLLQEFFHGKNLNLSINPDEAVAYGAAVQAAILSGDQSGKIQDVLLV 392
            :|.::||||||||:||:|.||::||:||.||.|||||||||:|||||||:|||.:...|:|||||
 Worm   331 KIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLV 395

  Fly   393 DVAPLSLGIETAGGVMTKLIERNCRIPCKQTKTFSTYSDNQPGVSIQVYEGERAMTKDNNALGTF 457
            |||||||||||||||||.||:||.|||.|..|||:||:||||||||||||||||||:||:.||||
 Worm   396 DVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTF 460

  Fly   458 DLSGIPPAPRGVPQIEVTFDLDANGILNVSAKEMSTGKAKNITIKNDKGRLSQAEIDRMVNEAEK 522
            :|||||||||||||||||||:||||||||||::.||||:..|||:|:||||:|::|||||:||::
 Worm   461 ELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQ 525

  Fly   523 YADEDEKHRQRITSRNALESYVFNVKQSVEQAPAGKLDEADKNSVLDKCNETIRWLDSNTTAEKE 587
            :..||.:.|:|:.:||.||:|.|.:||::::. :.||...|.:...:..:||:||||||:.|||:
 Worm   526 FEKEDGEQRERVQARNQLEAYAFQIKQALDEY-SSKLSTEDASRAKEAVDETLRWLDSNSLAEKD 589

  Fly   588 EFDHKMEELTRHCSPIMTKMHQQG-----AGAAGGPGANCGQQAGGF--GGY-SGPTVEEVD 641
            |.:.|.:||...|..|:|||||.|     ||.||.||      ..||  ..| .||||||||
 Worm   590 EIEAKDKELKSVCQSILTKMHQSGQSSASAGCAGNPG------TAGFNPNNYPQGPTVEEVD 645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp70BcNP_650209.1 PTZ00009 2..641 CDD:240227 444/646 (69%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 279/376 (74%)
F44E5.4NP_496509.1 PTZ00009 1..645 CDD:240227 444/646 (69%)
HSPA1-2_6-8-like_NBD 6..382 CDD:212675 279/376 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.