DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: heph and MRD1

Sequence 1:NP_001247399.1 Gene:heph FlyBaseID:FBgn0011224 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_015437.1 Gene:MRD1 SGDID:S000006316 Length:887 Species:Saccharomyces cerevisiae

Alignment Length:663 Identity:137/664 (21%)
Similarity:231/664 (35%) Gaps:210/664 (32%)


  Fly   307 KKVRIDEQYIYKLNYLRGSDELLSQAAVMAPASD---NNNQDLATKKAKLEPGTV-------LAG 361
            ::|||.|                |:|.....:|.   ..|:.|.|||.:.....|       || 
Yeast   290 RRVRIKE----------------SEAETREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELA- 337

  Fly   362 GIAKASKV--IHLRNIPNESGEADVIALGIPFGRVTNVLVL------KGKNQAFIEMADEISATS 418
             |.|.::.  :.||||...|.|.|...|..|||.:..|.|.      :.|..|::...|..:|  
Yeast   338 -IEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNA-- 399

  Fly   419 MVSCYTVTPPQM-RGRMVYV----QFSNHR---------------ELKTDQGHNNSTA--HSDYS 461
             |:.|.....|: :||::::    :..:||               |||.....:..|.  :|.|.
Yeast   400 -VNAYVELDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYM 463

  Fly   462 VQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGN------------TNAAGG 514
            .|....|     |.||......:......||:..:.|..:..:..|:            |..:..
Yeast   464 NQDAVLG-----SVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQL 523

  Fly   515 PNTVLR----VIVESLMYPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSL 575
            .:|..|    ::|::..:..:.:.|.::|..|||:.:::.......  |::|:.|..||:.|.:.
Yeast   524 KSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTI--AIVQFRDTTSARAAFTK 586

  Fly   576 LDGQNIYNG----------CCTLRIDNSKLTALNVKYNNDKSRDFTNPALPPGEPGVDIMPTAGG 630
            |..:...:|          |.|...:...|      .||..:::..||        |::.|::..
Yeast   587 LSYKRFKDGIIYLERGPKDCFTKPAEADDL------INNTSAKEEENP--------VEVKPSSND 637

  Fly   631 LMNTNDLLLIAARQRPSLSVNGLGAPGVLPPFALGLGTPLTGGYNNAL-------PNLAAFSLAN 688
            ||..|                                ..:|.|.:||.       |.::.| :.|
Yeast   638 LMEAN--------------------------------KDVTEGSSNAHDEDVIDGPTVSIF-IKN 669

  Fly   689 SGALQTTAPAMRGYSNVLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDS--------AL 745
                             |..|..|:.:.....:||.|    .|.:||...:.|..        ..
Yeast   670 -----------------LNFSTTNQNLTDRFKVFTGF----VVAQVKTKPDPKHQGKTLSMGFGF 713

  Fly   746 IQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPKEGQPDAGLTRDYSQNPLHRFKKPGS 810
            ::....:||...::.:|...:.|..|::..|..||.|        :|.|:..|.      ||.|.
Yeast   714 VEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQ--------SGNTKTKSN------KKSGK 764

  Fly   811 KNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSF----EVKAFKFFPKD-RKMALLQLLSVEE 870
                        :.:.|:|...:..|:.|.|  |||    .|:..|.|.|. |..|.::.|..:|
Yeast   765 ------------IIVKNLPFEATRKDVFELF--NSFGQLKSVRVPKKFDKSARGFAFVEFLLPKE 815

  Fly   871 AVLALIKMHNHQL 883
            |..|:.::|...|
Yeast   816 AENAMDQLHGVHL 828

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hephNP_001247399.1 hnRNP-L_PTB 366..898 CDD:273733 120/595 (20%)
RRM1_PTBP1_like 368..448 CDD:241132 27/108 (25%)
RRM2_PTBP1_like 516..611 CDD:241137 21/109 (19%)
RRM3_PTBP1_like 705..778 CDD:240869 16/81 (20%)
RRM4_PTBP1_like 822..897 CDD:240871 20/68 (29%)
MRD1NP_015437.1 RRM1_MRD1 2..92 CDD:241009
RRM_u2 96..346 CDD:293257 17/74 (23%)
RRM 222..612 CDD:223796 75/350 (21%)
RRM2_MRD1 343..421 CDD:241010 22/81 (27%)
RRM3_MRD1 532..603 CDD:241012 14/73 (19%)
RRM4_MRD1 663..746 CDD:240765 18/105 (17%)
RRM5_MRD1 763..837 CDD:241014 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.