DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: heph and Ptbp3

Sequence 1:NP_001247399.1 Gene:heph FlyBaseID:FBgn0011224 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_006238268.1 Gene:Ptbp3 RGDID:621671 Length:554 Species:Rattus norvegicus

Alignment Length:602 Identity:305/603 (51%)
Similarity:381/603 (63%) Gaps:88/603 (15%)


  Fly   323 RGSDELLSQAAVMAPASDNNNQDLA-------TKKAKLE--PGTVLAGGIAKASKVIHLRNIPNE 378
            |||||||....:..|::.||:....       .||.|.:  |        ...|:|:|||.||.:
  Rat    15 RGSDELLPSGVINGPSTMNNSTSAGVYANGNDNKKFKGDRPP--------CSPSRVLHLRKIPCD 71

  Fly   379 SGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHR 443
            ..||:||:||:|||:|||:|:||||:|||:|||.|.:|.:|::.||...|.:|.:.||:|:||||
  Rat    72 VTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHR 136

  Fly   444 ELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAG-- 506
            |||||.                     ||..|.|.|.                ||..|||.:|  
  Rat   137 ELKTDN---------------------LPNQARAQAA----------------LQAVSAVQSGNL 164

  Fly   507 ---GNTNAAG----GPNTVLRVIVESLMYPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYP 564
               |.|:..|    |.:.|||:|:|:|.|||:|::|||||.::|.||||:||||||.||||:||.
  Rat   165 SLPGATSNEGTLLPGQSPVLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYA 229

  Fly   565 DANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTALNVKYNNDKSRDFTNPALPPGEPGVDIMPT-- 627
            |..:||:||..||||||||.|||||||.||||:||||||||||||||...||.|:....:.|.  
  Rat   230 DPVNAQYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMA 294

  Fly   628 ----AGGLMNTNDLLLIAARQRPSLSVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAFSLAN 688
                |.|:|::           |.....|. ||.:..|.|.||......|   ||..|...|.|.
  Rat   295 AAFGAPGIMSS-----------PYAGAAGF-APAIAFPQAAGLSVSAVPG---ALGPLTLTSSAV 344

  Fly   689 SGALQTTAPAMRGY--SNVLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEP 751
            ||.:  ..|...|.  ::||||:|||.:.:||..||.||||||||.||||::|||::||:|||:.
  Rat   345 SGRM--AIPGASGIPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADA 407

  Fly   752 QQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNI 816
            .||.:||:||...||:||.:|...|||||||||:|||.|.|||:|:|.:||||||||||||:|||
  Rat   408 SQAQIAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNI 472

  Fly   817 YPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNH 881
            :||||||||||||.|.:.||:|..||.....|||||||.|||||||:||.|||||:.|||::|||
  Rat   473 FPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNH 537

  Fly   882 QLSESNHLRVSFSKSNI 898
            .|.|::|||||||||.|
  Rat   538 DLGENHHLRVSFSKSTI 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hephNP_001247399.1 hnRNP-L_PTB 366..898 CDD:273733 290/549 (53%)
RRM1_PTBP1_like 368..448 CDD:241132 47/80 (59%)
RRM2_PTBP1_like 516..611 CDD:241137 69/95 (73%)
RRM3_PTBP1_like 705..778 CDD:240869 44/73 (60%)
RRM4_PTBP1_like 822..897 CDD:240871 52/75 (69%)
Ptbp3XP_006238268.1 RRM1_ROD1 56..145 CDD:241223 52/118 (44%)
hnRNP-L_PTB 59..554 CDD:273733 290/549 (53%)
RRM2_PTBP1_like 181..276 CDD:241137 69/95 (73%)
RRM_SF 361..453 CDD:302621 59/92 (64%)
RRM4_ROD1 474..554 CDD:241147 56/80 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77600543
eggNOG 1 0.900 E1_KOG1190
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 547 1.000 Inparanoid score I1092
OMA 1 1.010
OrthoDB 1 1.010 D1545178at2759
OrthoFinder 1 1.000 FOG0000828
OrthoInspector 1 1.000 T617241
orthoMCL 1 0.900 OOG5_127719
Panther 1 1.100 O PTHR15592
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.