DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: heph and ptbp1b

Sequence 1:NP_001247399.1 Gene:heph FlyBaseID:FBgn0011224 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001116126.1 Gene:ptbp1b ZFINID:ZDB-GENE-030131-9796 Length:564 Species:Danio rerio

Alignment Length:634 Identity:300/635 (47%)
Similarity:388/635 (61%) Gaps:110/635 (17%)


  Fly   299 TSLHLSSPKKVRIDEQYIYKLNYLRGSDELLSQAA----VMAPASDNNNQDLATKKAKLEPGTVL 359
            |.|:........:|..:...:...||||||.|...    :|:.|::.|:    :||.|       
Zfish     7 TELYPMGSSYAELDVVHDIAVGTKRGSDELFSCVTSGPYIMSSAANGND----SKKFK------- 60

  Fly   360 AGGI---AKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVS 421
             |.|   |..|:|||:|.:||:..||:|||||:|||:|||:|:||||||||:||..|.:|.:||:
Zfish    61 -GDIRSPAVPSRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMVT 124

  Fly   422 CYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANS 486
            .|:...|.:|...:::|:|||:|||||...|...|.:                            
Zfish   125 YYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQA---------------------------- 161

  Fly   487 SSDSNSAMGILQNTSAVNAG----GNTNAAG--GPNTVLRVIVESLMYPVSLDILHQIFQRYGKV 545
                     .||..:||..|    |..:.:|  ||:.|||||||:|.|||:||:|||||.::|.|
Zfish   162 ---------ALQAVNAVQTGSLTLGGVDPSGMTGPSPVLRVIVENLFYPVTLDVLHQIFSKFGTV 217

  Fly   546 LKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTALNVKYNNDKSRDF 610
            ||::||||||.||||:|:.|..:|||||..|||||||||||||||..||||:||||||||||||:
Zfish   218 LKVITFTKNNQFQALLQFTDGLTAQHAKLALDGQNIYNGCCTLRISFSKLTSLNVKYNNDKSRDY 282

  Fly   611 TNPALPPGEPGVDIMPTAGGLMNTNDLLLIAARQRPSLSVNGL----GAPGVL------------ 659
            |.|.||.|:                        .:|:|..:.:    .|||::            
Zfish   283 TRPDLPTGD------------------------SQPALEHHAVAAAFAAPGIISAAPYASAHAFP 323

  Fly   660 PPFAL---GLGTPLTGGYNNALPNLA--AFSLANSGALQTTAPAMRGYSNVLLVSNLNEEMVTPD 719
            |.||:   ||..|   |...||.:|.  ..:.|.:.|.:...|.:.|...|:||||||.|.|||.
Zfish   324 PAFAIQQAGLTIP---GVPGALASLTIPGAAAAAAAASRLGFPTLTGTHCVMLVSNLNPERVTPH 385

  Fly   720 ALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLP 784
            .||.||||||||.||||::|||::|||||::..||.||||||:..:|:|:|:|:..|||..||:|
Zfish   386 CLFILFGVYGDVLRVKIMFNKKENALIQMSDGTQAQLAMSHLNGQKLYGRPLRITLSKHTTVQMP 450

  Fly   785 KEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVK 849
            :||..|.|||:|||.:|||||||||||||.||:|||:||||||||.|..|||:|..|.|:...||
Zfish   451 REGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKLLFGSSGALVK 515

  Fly   850 AFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 898
            .||||.|||||||:|:.|||||:.:||:.|||.|.|::|||||||||.|
Zfish   516 NFKFFQKDRKMALIQMSSVEEAIESLIQFHNHDLGENHHLRVSFSKSTI 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hephNP_001247399.1 hnRNP-L_PTB 366..898 CDD:273733 280/559 (50%)
RRM1_PTBP1_like 368..448 CDD:241132 45/80 (56%)
RRM2_PTBP1_like 516..611 CDD:241137 70/95 (74%)
RRM3_PTBP1_like 705..778 CDD:240869 47/73 (64%)
RRM4_PTBP1_like 822..897 CDD:240871 50/75 (67%)
ptbp1bNP_001116126.1 hnRNP-L_PTB 69..564 CDD:273733 280/559 (50%)
RRM_SF 71..151 CDD:302621 45/80 (56%)
RRM2_PTBP1_like 188..283 CDD:241137 70/95 (74%)
RRM_SF 371..463 CDD:302621 58/92 (63%)
RRM_SF 484..564 CDD:302621 53/80 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77689296
eggNOG 1 0.900 E1_KOG1190
Hieranoid 1 1.000
Homologene 1 1.000 H49188
Inparanoid 1 1.050 525 1.000 Inparanoid score I1178
OMA 1 1.010
OrthoDB 1 1.010 D1545178at2759
OrthoFinder 1 1.000 FOG0000828
OrthoInspector 1 1.000 T595791
orthoMCL 1 0.900 OOG5_127719
Panther 1 1.100 LDO PTHR15592
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.