DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: heph and Zfp638

Sequence 1:NP_001247399.1 Gene:heph FlyBaseID:FBgn0011224 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_006505767.1 Gene:Zfp638 MGIID:1203484 Length:2056 Species:Mus musculus

Alignment Length:681 Identity:128/682 (19%)
Similarity:231/682 (34%) Gaps:209/682 (31%)


  Fly   220 SRTTTTTTKKQPQAVADAVLSAV-GGNVGTAVGGGTISSLLGPEPLPIMPHHLPLASVRGCSSAS 283
            ||.:..:.:|  :|:.|....:| |..|.......|:...|.|...|      .|||  |...::
Mouse   663 SRKSVRSDRK--KALEDGGQRSVHGTEVTKQKHTETVDKGLSPAQKP------KLAS--GTKPSA 717

  Fly   284 SGCSSASSDCSMPSPTSLHLSSPKKVRIDEQYIYKLNYLRGSDELLSQAAVMAPASDNNNQDLAT 348
            ...||..||.        ||.:               |.....|.|....:.....::....||.
Mouse   718 KSLSSVKSDS--------HLGA---------------YSAHKSENLEDDTLPEGKQESGKSALAQ 759

  Fly   349 KKAKLEPGTVLAGGIAKASKVIHLRNIPNESG--EADVIALGIPFGRVTNVLVLKGKNQAFIEMA 411
            :|.:.:..       ..::.::.:..:| |.|  |.|:....:|||::::||::..:|:|::||.
Mouse   760 RKPQKDQS-------LSSNSILLVSELP-EDGFTEEDIRKAFLPFGKISDVLLVPCRNEAYLEME 816

  Fly   412 DEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAA 476
            ...:.||::......|..::|:.|.|.....   |..|........||.   ..:|.|.|.....
Mouse   817 LRKAVTSIMKYIETMPLVIKGKSVKVCVPGK---KKPQNKEMKKKPSDI---KKSSASALKKETD 875

  Fly   477 ANATSNNANSSSDSNSAMGILQNTSAVN--AGGNTNAAGGPNTVLRVIVESLMYPVSLDILHQIF 539
            |:.|....:|||.:.|.. |..:|..||  ||   .:||...:|:.|..:               
Mouse   876 ASKTMETVSSSSSAKSGQ-IKSSTVKVNKCAG---KSAGSVKSVVTVAAK--------------- 921

  Fly   540 QRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTALNVKYNN 604
               ||.                   ...:|:..|..|:.:                     |..|
Mouse   922 ---GKA-------------------SIKTAKSGKKSLEAK---------------------KSGN 943

  Fly   605 DKSRDFTNPALPPGEPGVDIMPTAGGLMNTNDLLLIAARQRPSLSVNGLGAPGVLPPFALGLGTP 669
            .|::|...|...|                .|..:..::..:                        
Mouse   944 IKNKDSNKPVTVP----------------ANSEIKASSEDK------------------------ 968

  Fly   670 LTGGYNNALPNLAAFSLANSGALQTT--APAMRGYS--NVLLVSNLNEEMVTPDALFTLFGVYGD 730
            .||......|         ||.|:.|  .|..:...  :|:.:|||..:..:.:.::.|...:|.
Mouse   969 ATGKSAEESP---------SGTLEATEKEPVNKESEEMSVVFISNLPNKGYSTEEIYNLAKPFGA 1024

  Fly   731 VQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRV-MASKHQAVQ--------LPKE 786
            ::.:.:|.:.|.:.:....:...:.:.......:.:.|..:.: ||.:|..::        |.:|
Mouse  1025 LKDILVLSSHKKAYIEINKKSADSMVKFYTCFPISMDGNQLSISMAPEHVDLKDEEALFTTLIQE 1089

  Fly   787 GQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAF-TSNSF-EVK 849
            ..|:|.:.:.|     :||                 :||.|:|    ||.::... ..:.| :|.
Mouse  1090 NDPEANIDKIY-----NRF-----------------VHLDNLP----EDGLQCVLCVGHQFGKVD 1128

  Fly   850 AFKFFPKDRKMALLQLLSVEEAVLALIKMHN 880
            .:.|.....|: :|||.|.|.|    :.|:|
Mouse  1129 RYMFMSNKNKV-ILQLESPESA----LSMYN 1154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hephNP_001247399.1 hnRNP-L_PTB 366..898 CDD:273733 100/535 (19%)
RRM1_PTBP1_like 368..448 CDD:241132 21/82 (26%)
RRM2_PTBP1_like 516..611 CDD:241137 11/95 (12%)
RRM3_PTBP1_like 705..778 CDD:240869 11/74 (15%)
RRM4_PTBP1_like 822..897 CDD:240871 18/62 (29%)
Zfp638XP_006505767.1 RRM_SF 772..847 CDD:302621 20/76 (26%)
RRM1_2_NP220 998..1072 CDD:241160 11/74 (15%)
RRM1_2_MATR3_like 1102..1175 CDD:240882 20/80 (25%)
PBP1 1190..>1533 CDD:227507
ZnF_U1 2005..2037 CDD:197732
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15592
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.