DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pp1-13C and PPZ1

Sequence 1:NP_524921.1 Gene:Pp1-13C FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_013696.1 Gene:PPZ1 SGDID:S000004478 Length:692 Species:Saccharomyces cerevisiae

Alignment Length:295 Identity:187/296 (63%)
Similarity:225/296 (76%) Gaps:1/296 (0%)


  Fly     5 LNLESIISRLLEV-RGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYY 68
            ::::..|.:||:. ..|:..|||.|...||..:|:|:|||.|:||.||||..|:||.||:||||.
Yeast   361 IDIDETIQKLLDAGYAAKRTKNVCLKNNEILQICIKAREIFLSQPSLLELSPPVKIVGDVHGQYG 425

  Fly    69 DLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYG 133
            ||||||...|:||.:|||||||||||||||||||.||..|||||.|||||||||||||::.|:||
Yeast   426 DLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLFCYKIKYPENFFLLRGNHECANVTRVYG 490

  Fly   134 FYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGL 198
            ||||||||..||:||||.|.||.||:.|||..||||.||||||.|.||::||.::|||||||.||
Yeast   491 FYDECKRRCNIKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDEIRHVVRPTDVPDFGL 555

  Fly   199 LCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVT 263
            :.|||||||......|.:|:||||:.:....:.|||.|...||:||||.|||||||||..|.|||
Yeast   556 INDLLWSDPTDSPNEWEDNERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVT 620

  Fly   264 LFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVE 298
            :||||||||||||.||:|||...|:|||::|.|::
Yeast   621 VFSAPNYCGEFDNWGAVMSVSEGLLCSFELLDPLD 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 187/296 (63%)
MPP_PP1_PPKL 6..296 CDD:277359 186/291 (64%)
PPZ1NP_013696.1 PTZ00480 361..657 CDD:185658 187/296 (63%)
MPP_PP1_PPKL 362..653 CDD:277359 186/291 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284266585
eggNOG 1 0.900 E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000155
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.