DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pp1-13C and TOPP3

Sequence 1:NP_524921.1 Gene:Pp1-13C FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_176587.1 Gene:TOPP3 AraportID:AT1G64040 Length:322 Species:Arabidopsis thaliana

Alignment Length:294 Identity:223/295 (76%)
Similarity:255/295 (86%) Gaps:0/295 (0%)


  Fly     7 LESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLL 71
            ::.:|.|||..:..:..|.|||:|.||:.||..:::|.|.||.|||||||:|||||.|||:.|||
plant     6 VDDVIKRLLGAKNGKTTKQVQLTEAEIKHLCSTAKQIFLTQPNLLELEAPIKICGDTHGQFSDLL 70

  Fly    72 RLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYD 136
            ||||||||||.||||||||||||||||:|||||||||||||.|||||||||||||||||||||||
plant    71 RLFEYGGYPPAANYLFLGDYVDRGKQSVETICLLLAYKIKYKENFFLLRGNHECASINRIYGFYD 135

  Fly   137 ECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCD 201
            |||:||::::||.||||||||||.|::||||.|.||||||:|..:::||.|.||.|:||.|||||
plant   136 ECKKRYSVRVWKIFTDCFNCLPVAALIDEKILCMHGGLSPELKHLDEIRNIPRPADIPDHGLLCD 200

  Fly   202 LLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFS 266
            |||||||||..||||||||||:||||:.|.:|||.|||||||||||||||||||||.|||||:||
plant   201 LLWSDPDKDIEGWGENDRGVSYTFGADKVEEFLQTHDLDLICRAHQVVEDGYEFFANRQLVTIFS 265

  Fly   267 APNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKR 300
            ||||||||||||||||||::|.|||||||..||:
plant   266 APNYCGEFDNAGAMMSVDDSLTCSFQILKASEKK 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 222/292 (76%)
MPP_PP1_PPKL 6..296 CDD:277359 221/289 (76%)
TOPP3NP_176587.1 MPP_PP1_PPKL 5..294 CDD:277359 220/288 (76%)
PTZ00480 6..315 CDD:185658 223/295 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I289
OMA 1 1.010
OrthoDB 1 1.010 D766640at2759
OrthoInspector 1 1.000 T32361
orthoMCL 1 0.900 OOG5_126821
Panther 1 1.100 O PTHR11668
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.