DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pp1-13C and TOPP5

Sequence 1:NP_524921.1 Gene:Pp1-13C FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_190266.1 Gene:TOPP5 AraportID:AT3G46820 Length:312 Species:Arabidopsis thaliana

Alignment Length:297 Identity:229/298 (77%)
Similarity:256/298 (86%) Gaps:1/298 (0%)


  Fly     7 LESIISRLLEVRGARPG-KNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDL 70
            |:.||.|||:.|..:.| |...|::.|||.||..||||.|.||.||||.||:||||||||||.||
plant    14 LDDIIRRLLDYRNPKAGTKQAMLNDSEIRQLCFVSREIFLQQPCLLELAAPVKICGDIHGQYSDL 78

  Fly    71 LRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFY 135
            ||||||||:||.||||||||||||||||||||||||||||||.||||||||||||||||||||||
plant    79 LRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 143

  Fly   136 DECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLC 200
            ||||||:.:||||.|||.||||||.|::||||.|.||||||:|.::|||:.|.|||||||.||||
plant   144 DECKRRFNVKLWKVFTDTFNCLPVAAVIDEKILCMHGGLSPELINVEQIKNIERPTDVPDAGLLC 208

  Fly   201 DLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLF 265
            |||||||.||..|||.||||||:||||:.|.:||.|:|:||:|||||||||||||||.|||||:|
plant   209 DLLWSDPSKDVKGWGMNDRGVSYTFGADKVAEFLIKNDMDLVCRAHQVVEDGYEFFADRQLVTMF 273

  Fly   266 SAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRKK 302
            ||||||||||||||:||||.:|||||||||||::|.:
plant   274 SAPNYCGEFDNAGALMSVDESLMCSFQILKPVDRRSR 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 228/293 (78%)
MPP_PP1_PPKL 6..296 CDD:277359 226/290 (78%)
TOPP5NP_190266.1 PTZ00480 1..307 CDD:185658 228/293 (78%)
MPP_PP1_PPKL 13..304 CDD:277359 226/290 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I289
OMA 1 1.010
OrthoDB 1 1.010 D766640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126821
Panther 1 1.100 O PTHR11668
Phylome 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.