DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pp1-13C and PPP1CC

Sequence 1:NP_524921.1 Gene:Pp1-13C FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_011536806.1 Gene:PPP1CC HGNCID:9283 Length:362 Species:Homo sapiens

Alignment Length:303 Identity:276/304 (91%)
Similarity:288/304 (95%) Gaps:2/304 (1%)


  Fly     1 MAEV--LNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDI 63
            ||::  ||::|||.|||||||::|||||||.|.||||||||||||.|:|||||||||||||||||
Human     1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI 65

  Fly    64 HGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASI 128
            |||||||||||||||:|||:|||||||||||||||||||||||||||||.|||||||||||||||
Human    66 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 130

  Fly   129 NRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDV 193
            ||||||||||||||.|||||||||||||||:.||||||||||||||||||.||||||||||||||
Human   131 NRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDV 195

  Fly   194 PDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAK 258
            |||||||||||||||||.:||||||||||||||||||.|||.|||||||||||||||||||||||
Human   196 PDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAK 260

  Fly   259 RQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRK 301
            ||||||||||||||||||||||||||.|||||||||||.||:|
Human   261 RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 272/294 (93%)
MPP_PP1_PPKL 6..296 CDD:277359 269/290 (93%)
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 274/299 (92%)
MPP_PP1_PPKL 8..298 CDD:277359 269/290 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284207763
eggNOG 1 0.900 E1_COG0639
Hieranoid 1 1.000
Homologene 1 1.000 H100608
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D327461at33208
OrthoFinder 1 1.000 FOG0000155
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126821
Panther 1 1.100 O PTHR11668
Phylome 1 0.910 0.605 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.