DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pp1-13C and pef-1

Sequence 1:NP_524921.1 Gene:Pp1-13C FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_741091.1 Gene:pef-1 WormBaseID:WBGene00003969 Length:707 Species:Caenorhabditis elegans

Alignment Length:270 Identity:92/271 (34%)
Similarity:141/271 (52%) Gaps:29/271 (11%)


  Fly    39 KSREILLAQP----ILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEAN-YLFLGDYVDRGKQS 98
            ::|:|..|.|    |...:...:.||||:||::.||..:....|||...| |:|.||:||||.||
 Worm   229 EARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQS 293

  Fly    99 LETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRY---TIKLWKTFTDCFNCLPVV 160
            :|.:|:|.|..|....:.:|.|||||...:|..|||..|...:|   :..:.:...|.|:.||:.
 Worm   294 IEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIA 358

  Fly   161 AIVDEKIFCCHGGLS--PDLTSMEQIRR-----IMRP--------------TDVPDQGLLCDLLW 204
            .|:|..||..|||:|  .:::.:::|.|     ::||              .:|.:...:.|::|
 Worm   359 TIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMW 423

  Fly   205 SDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPN 269
            |||.::...|....||....|||::...||:||...|:.|:|:...:||||......:|:|||.|
 Worm   424 SDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASN 488

  Fly   270 YCGEFDNAGA 279
            |.....|.||
 Worm   489 YYETGSNRGA 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 92/271 (34%)
MPP_PP1_PPKL 6..296 CDD:277359 92/271 (34%)
pef-1NP_741091.1 MPP_RdgC 199..515 CDD:277364 92/271 (34%)
PP2Ac 218..514 CDD:197547 92/271 (34%)
EFh 634..699 CDD:238008
EF-hand_7 634..698 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.