DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dip-B and Lap3

Sequence 1:NP_001287316.1 Gene:Dip-B FlyBaseID:FBgn0000454 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001011910.1 Gene:Lap3 RGDID:1307985 Length:519 Species:Rattus norvegicus

Alignment Length:432 Identity:109/433 (25%)
Similarity:177/433 (41%) Gaps:82/433 (19%)


  Fly    79 DDVRSYQEAAKRSMEKVLKAGF-HTPLLFVPKVKRFPEVELC-----TVLGALEQLYVPIQLREA 137
            ||..::.| .|.::...:.||. ....|.:|.|    ||:.|     ...||:..||      |.
  Rat   109 DDQENWHE-GKENIRAAVAAGCRQVQDLELPSV----EVDPCGDAQAAAEGAVLGLY------EY 162

  Fly   138 GTLKDPRVTTLSVQIDDPRAEAIFQEALILEAGRFVARDIGVGDPERMTPIQ----VEKYIKPLF 198
            ..||..:...:|.::........:::.::..:|:.:||.:.......|||.:    :||.:|...
  Rat   163 DDLKQKKKVAVSAKLHGSGDLEAWEKGVLFASGQNLARQLMESPANEMTPTRFAEVIEKNLKSAS 227

  Fly   199 DKLNVNVISDTQVLQKEYPLFAAVNRAADAVERHRGRIIFLEYK---PPKPARKTLMLVGKGVTY 260
            .|..|::.:.:.:.::|...|.:|.:.::...      :|||..   .|......|:.||||:|:
  Rat   228 SKTEVHIRTKSWIEEQEMGSFLSVAKGSEEPP------VFLEIHYTGSPNATEAPLVFVGKGITF 286

  Fly   261 DTGGADIKAGGVMAGMSRDKCGAAAVAGFMQVVSQLQ-PDDIHVVAALCMVRNSVGEECYVADEV 324
            |:||..|||...|..|..|..|||.:...:...::|. |.:|..:|.||  .|....:.....:|
  Rat   287 DSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLC--ENMPSGKANKPGDV 349

  Fly   325 ITSRAGLHVRIGNTDAEGRMCMTDALCRMKELVVEQNLPDPHLF------TIATLTGHAFISAGE 383
            :.:|.|..:::.|||||||:.:.||||.            .|.|      ..|||||...::.|.
  Rat   350 VRARNGKTIQVDNTDAEGRLILADALCY------------AHTFNPKVIINAATLTGAMDVALGS 402

  Fly   384 GQSIAIDNSVAHREDHARRLQAAGQAFGEPFEVS------ILRPSDFSFNAGKVIGEDLVQANNA 442
            |.:....||              ...:.:.||.|      :.|...|.....:||...|...||.
  Rat   403 GATGVFTNS--------------SWLWNKLFEASVETGDRVWRMPLFEHYTRQVIDCQLADVNNL 453

  Fly   443 PSVRTPRGHQVPAAFMIKASGLDKHGLDSMLPIKYTHIDIAG 484
            ...|: .|....|||:          .:.:...|:.|:||||
  Rat   454 GKYRS-AGACTAAAFL----------REFVTHTKWAHLDIAG 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dip-BNP_001287316.1 Peptidase_M17 58..502 CDD:238247 109/433 (25%)
Lap3NP_001011910.1 Peptidase_M17 33..511 CDD:238247 109/433 (25%)
PRK00913 36..512 CDD:234863 109/433 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.