DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab2 and Cpr65Ay

DIOPT Version :9

Sequence 1:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001097524.1 Gene:Cpr65Ay / 5740348 FlyBaseID:FBgn0085300 Length:109 Species:Drosophila melanogaster

Alignment Length:105 Identity:25/105 - (23%)
Similarity:46/105 - (43%) Gaps:20/105 - (19%)


  Fly     1 MKFL---IVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDG--------TSIKQEGVLK 54
            ||.|   .:..||.|: |:..:|.:..|:      ||......|.:|        .::|.|.|..
  Fly     1 MKLLSQVFLITALIAL-VSSASLEKGERE------EKLHFGFHTENGHQRNEAITYTVKPETVQD 58

  Fly    55 NAGTDNEAAVVH-GSFTWVDEKTGEKFTITYVADENGYQP 93
            ......:..|.: |.:::: ...|.::.:.|.|::||:||
  Fly    59 PKEVTTQKPVEYKGGYSFI-SADGYEYQVLYKANKNGFQP 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 11/59 (19%)
Cpr65AyNP_001097524.1 Chitin_bind_4 32..95 CDD:278791 11/63 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.