DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab2 and Acp65Aa

DIOPT Version :8

Sequence 1:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster

Alignment Length:112 Identity:49/112 - (43%)
Similarity:66/112 - (58%) Gaps:22/112 - (19%)


  Fly     1 MKFLIV---FVALFAMAVARPNLAEIVRQVSDVEPEKWSSD----------VETSDGTSIKQEGV 52
            ||.::|   ...|.|:|.|||.        :|||..::.|:          .:.|||||..:|||
  Fly     2 MKLMLVVGSIALLLALASARPQ--------NDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGV 58

  Fly    53 LKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHLP 99
            :.|||||||:..:.||.||| ...|:.:||.:||||||:||:|||||
  Fly    59 VNNAGTDNESISIRGSVTWV-APDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 28/50 (56%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131275723
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.