DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab2 and Cpr49Ad

DIOPT Version :8

Sequence 1:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster

Alignment Length:75 Identity:23/75 - (30%)
Similarity:41/75 - (54%) Gaps:3/75 - (4%)


  Fly    21 AEIVRQVSDVE--PEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTIT 83
            |.||.|.:||.  ...:|.:.||.:|...::.||..|.|...:...|.|:::::..: |.:..:.
  Fly    67 ARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPE-GLRVGVK 130

  Fly    84 YVADENGYQP 93
            |:||.||::|
  Fly   131 YLADANGFRP 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 14/50 (28%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.