DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab2 and Cpr60D

DIOPT Version :8

Sequence 1:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001286853.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster

Alignment Length:100 Identity:18/100 - (18%)
Similarity:45/100 - (45%) Gaps:19/100 - (19%)


  Fly     4 LIVFVALFAMAVARPNLAEIVRQVSDVEPE---------KWSSDVETSDGTSIKQEGVLKNAGTD 59
            ::.:..:||:.|...:.:|...|...::.|         ::..::..|:|..:|.:|.:..    
  Fly     1 MLKYSLIFALFVVLASCSEEDLQAQLLKSENRQNLDGAGQFQHEITVSNGIQVKAQGNVNG---- 61

  Fly    60 NEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQ 94
                 :.|.: ::..:.|::..:||.||..|:.|:
  Fly    62 -----IQGEY-FLPGEDGKQIRVTYTADATGFHPK 90

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 10/50 (20%)
Cpr60DNP_001286853.1 Chitin_bind_4 41..87 CDD:278791 10/55 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.