DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD8 and GstD9

Sequence 1:NP_524916.1 Gene:GstD8 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster

Alignment Length:208 Identity:127/209 (61%)
Similarity:164/209 (78%) Gaps:2/209 (1%)


  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65
            :||||...||||||::|||:|||::||.|.:.:..||.|||||||:||||.|||||||||:||||
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66

  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNN--HPADPEAMQ 128
            |||||||.|||..|.||||.|||::||:||||:||:.||:||:|...|||:..:  .||||:.::
  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131

  Fly   129 KVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEVTPGW 193
            |:|.||...:|.|:.|:|.|.:.||:||.||||:|||||:.::|..:||.|.|||:|||:|.|||
  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGW 196

  Fly   194 EENWDGVQLIKKL 206
            ||||:|.:..|||
  Fly   197 EENWEGCEYYKKL 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 115/189 (61%)
GST_N_Delta_Epsilon 1..74 CDD:239343 52/73 (71%)
GST_C_Delta_Epsilon 88..204 CDD:198287 62/118 (53%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 52/73 (71%)
GstA 4..187 CDD:223698 111/183 (61%)
GST_C_Delta_Epsilon 89..207 CDD:198287 62/118 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131160694
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_126942
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.