DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD8 and GstE3

Sequence 1:NP_524916.1 Gene:GstD8 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster

Alignment Length:189 Identity:78/190 (41%)
Similarity:121/190 (64%) Gaps:3/190 (2%)


  Fly     9 SAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLV 73
            |.|.|||::|.:||.:|.:.|::.:|:.|.|||||:|:||.|.:|.|.|:||.:.:|.||..|||
  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76

  Fly    74 EKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEA-MQKVDSAFGHL 137
            .|||.:|||||.|.:|:|:|:|||::|...:..:.....:|....|....|:| :..::..:..|
  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSL 141

  Fly   138 DTFLEDQEYVAGDCLTIADIALLASVSTFEV-VDFDIAQYPNVARWYENAKEVTPGWEE 195
            :.|||:..|:|||.|||||..::|.::.|.| :..|..:||.:|.|.:..||: |.:||
  Fly   142 NLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-PYYEE 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 74/181 (41%)
GST_N_Delta_Epsilon 1..74 CDD:239343 32/65 (49%)
GST_C_Delta_Epsilon 88..204 CDD:198287 37/111 (33%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 75/184 (41%)
GST_N_Delta_Epsilon 4..77 CDD:239343 32/65 (49%)
GST_C_Delta_Epsilon 91..208 CDD:198287 37/111 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92094140
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.