DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD8 and Gstt1

Sequence 1:NP_524916.1 Gene:GstD8 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 MGIID:107379 Length:240 Species:Mus musculus

Alignment Length:229 Identity:61/230 (27%)
Similarity:107/230 (47%) Gaps:36/230 (16%)


  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65
            ::.|....|.|||::.:.||...:...|..:::..||.|...|.::||...:|.::|.||::.||
Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67

  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIR----NNHPADPE- 125
            .|||:||..||...|..||.|.|.:|.|::.|.:....|.:|.:.|::.::.    ......|| 
Mouse    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQIPPET 132

  Fly   126 ---AMQKVDSAFGHL-DTFLEDQEYVAGDCLTIADIALLASV--------STFEVVDFDIAQYPN 178
               .:.::|.....| |.||:|::::.|..:::||:..:..:        ..||       .:|.
Mouse   133 LAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVFE-------GHPR 190

  Fly   179 VARWYENAKEVTPGWEENWDGVQLIKKLVQERNE 212
            :|.||:.. |...|           |.|.:|.:|
Mouse   191 LAAWYQRV-EAAVG-----------KDLFREAHE 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 55/204 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/73 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/133 (20%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 60/228 (26%)
GST_N_Theta 3..78 CDD:239348 26/75 (35%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..217 CDD:198292 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95017666
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.