DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD7 and EEF1G

Sequence 1:NP_525114.1 Gene:GstD7 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001395.1 Gene:EEF1G HGNCID:3213 Length:437 Species:Homo sapiens

Alignment Length:218 Identity:58/219 (26%)
Similarity:91/219 (42%) Gaps:47/219 (21%)


  Fly    44 PEFVRINPQHTIPTLV-DNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGT 107
            |||:|..|...:|... |:||.::||.|||.|:      .:..|..:.|:..|.:.|.:.|....
Human    47 PEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV------SNEELRGSTPEAAAQVVQWVSFADSD 105

  Fly   108 LYDALTKYFFL---IFRTGKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVST 169
            :....:.:.|.   |....|...:.|.::|....|.|:.:|:.:.|:.|.::|:|||.:   |.|
Human   106 IVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITV---VCT 167

  Fly   170 VEWF-------SFDLSKFPNVERWLK---NAP--KVTPGWEQNLESLQQ--GKKFL--------- 211
            :.|.       || ...|||..||..   |.|  :...|..:..|.:.|  .|||.         
Human   168 LLWLYKQVLEPSF-RQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTP 231

  Fly   212 ----------QDLQAAKEKEVKA 224
                      |..||.:::|.||
Human   232 RKEKGSREEKQKPQAERKEEKKA 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/34 (44%)
GstA 6..188 CDD:223698 44/155 (28%)
GST_C_Delta_Epsilon 92..206 CDD:198287 31/129 (24%)
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 15/41 (37%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/126 (25%)
V-ATPase_G_2 <212..>278 CDD:330366 10/44 (23%)
EF1G 277..381 CDD:306993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.