DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD6 and GSTF12

Sequence 1:NP_524915.1 Gene:GstD6 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana

Alignment Length:208 Identity:46/209 (22%)
Similarity:89/209 (43%) Gaps:24/209 (11%)


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ||....:...:.|::.....|:||..|.::....||.:|..:...|...:|.:.|..|.::|:||
plant     5 LYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRA 69

  Fly    68 IVVYLVEQYG-KDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLE--- 128
            |..|...::. :..:|..|..:.:|:::|  :.|:.|.|..:......:....||...|..:   
plant    70 IARYYATKFADQGTNLLGKSLEHRAIVDQ--WADVETYYFNVLAQPLVINLIIKPRLGEKCDVVL 132

  Fly   129 ------KLNAAFDLLNNFLDGQDYVAGNQLSVADIV-------ILATVSTTEMVDFDLKKFPNVD 180
                  ||....|:.||.|....::||.:.::||:.       :::.....:||    |...:.:
plant   133 VEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMV----KARGSFN 193

  Fly   181 RWYKNAQKVTPGW 193
            ||::.... .|.|
plant   194 RWWEEISD-RPSW 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/71 (27%)
PLN02395 11..208 CDD:166036 44/201 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/123 (20%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 46/209 (22%)
GST_N_Phi 2..77 CDD:239351 19/72 (26%)
GST_C_Phi 91..209 CDD:198296 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.