DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD6 and GstE3

Sequence 1:NP_524915.1 Gene:GstD6 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster

Alignment Length:217 Identity:76/218 (35%)
Similarity:123/218 (56%) Gaps:14/218 (6%)


  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            :.||.:.|||..|:|::|.:|:.::|:...||....|.|:|.|:||||.||:|.|.||.|.:.::
  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLL---RTGKPGTQENL 127
            .||..|||.:||::|||||||.:|:|:::|||::|...:........|||.   :|..|  |..:
  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIP--QARI 131

  Fly   128 EKLNAAFDLLNNFLDGQDYVAGNQLSVADI-VILATVSTTEMVDFDLKKFPNVDRWYKNAQKVTP 191
            :.|...:..||.||:..:|:||:.|::||. ||.........:..|..|:|.:..|.|..::: |
  Fly   132 DALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-P 195

  Fly   192 GWDE-------NLARIQSAKKF 206
            .::|       .:.....:|||
  Fly   196 YYEEANGSRAAQIIEFIKSKKF 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 32/73 (44%)
PLN02395 11..208 CDD:166036 71/208 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/127 (25%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 71/194 (37%)
GST_N_Delta_Epsilon 4..77 CDD:239343 32/73 (44%)
GST_C_Delta_Epsilon 91..208 CDD:198287 32/120 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92094233
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.