DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD5 and GSTF3

Sequence 1:NP_524914.3 Gene:GstD5 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana

Alignment Length:206 Identity:51/207 (25%)
Similarity:81/207 (39%) Gaps:35/207 (17%)


  Fly     7 PRGSGCRTVIMVAKALGVK-LNMKLLNTLEKD--QLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68
            |..:..|.|::   ||..| |:.:|::...||  ..|..|:..||...:|...|....::|||||
plant    10 PASTSTRRVLI---ALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAI 71

  Fly    69 AVYLVEKYGKDDT-LFPKDPKKQALVNQRLYFDMG--------------TLYDSFAKYYYPLFHT 118
            ..|:..:|....| |.|.|.|.   :.|.....:|              ..::...|:.|.| :|
plant    72 TQYIAHRYENQGTNLLPADSKN---IAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGL-NT 132

  Fly   119 GKPGSDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVAD------IAILSTVSTFEIFDFDLNKYP 177
            .:....|:..|:....:.....|:...|:||:..|:.|      |..|....|.::|    .:.|
plant   133 DQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLF----TERP 193

  Fly   178 NVARWYANAKK 188
            .|..|.|...|
plant   194 RVNEWVAEITK 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 49/201 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/70 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/122 (20%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 51/207 (25%)
GST_N_Phi 4..78 CDD:239351 22/71 (31%)
GST_C_Phi 96..212 CDD:198296 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.