DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and URE2

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae

Alignment Length:187 Identity:52/188 (28%)
Similarity:81/188 (43%) Gaps:41/188 (22%)


  Fly    15 VIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNG---FSIWESRAIAVYLVEKY 76
            |.:|...||...|...|:...||...||||.:||...:|.|:|:|   .|||||.||.::||.||
Yeast   128 VAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWESGAILLHLVNKY 192

  Fly    77 GKD---DYLLPNDPKKRAVINQRLYFDMGTLYESFAK-YYYPLFRTGKPGS-----DEDLKRI-- 130
            .|:   ..|..:|...::.||..|:|..........: .::..|.:.|..|     .::::|:  
Yeast   193 YKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIASAVERYTDEVRRVYG 257

  Fly   131 ----------ETAFGFLDT-----------------FLEGQEYVAGDQLTVADIAIL 160
                      |.....|||                 |.:...::.||:||:||:|.:
Yeast   258 VVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIADLAFV 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 27/62 (44%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/109 (18%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 29/66 (44%)
GST_C_Ure2p 208..350 CDD:198326 20/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126942
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.810

Return to query results.
Submit another query.