DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and GSTF11

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana

Alignment Length:191 Identity:52/192 (27%)
Similarity:85/192 (44%) Gaps:38/192 (20%)


  Fly    37 EQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKY---GKDDYLLPNDPKKRAVINQRLY 98
            ||.||:.:...|...:|.:.|....::||||||.|...||   |.|  ||....:.||:::|.: 
plant    39 EQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQGTD--LLGKTLEGRAIVDQWV- 100

  Fly    99 FDMGTLYESFAKYYY----PLF-------RTGKP---GSDEDLK-RIETAFGFLDTFLEGQEYVA 148
                   |....|:|    ||.       ::|||   ...|:|| :.:......:..|....|:.
plant   101 -------EVENNYFYAVALPLVMNVVFKPKSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLG 158

  Fly   149 GDQLTVADIAILSTVSTFEVSEFDFS----KYSNVSRWYDNAKKVTPGWDENWEGLMAMKA 205
            ||:.|:||::.:..: .:.::|...|    ...|::||: |.....|.|.:    ||.:.|
plant   159 GDEFTLADLSHMPGM-RYIMNETSLSGLVTSRENLNRWW-NEISARPAWKK----LMELAA 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/37 (38%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/135 (23%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 52/192 (27%)
GST_N_Phi 2..77 CDD:239351 14/38 (37%)
GST_C_Phi 91..209 CDD:198296 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.