DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and GSTF10

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana

Alignment Length:222 Identity:59/223 (26%)
Similarity:91/223 (41%) Gaps:52/223 (23%)


  Fly     5 YMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIA 69
            |.|.....:..::.....|:......::.|:|||.:||::.:.|...||.|||..:.|:|||||.
plant     6 YAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIM 70

  Fly    70 VYLVEKY---GKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFR----------TGKP 121
            .|:.|||   |.|  ||....::|..:.|.|..:.       ..|:.||..          .|.|
plant    71 RYIAEKYRSQGPD--LLGKTIEERGQVEQWLDVEA-------TSYHPPLLALTLNIVFAPLMGFP 126

  Fly   122 GSDEDLKRIETAFG-FLDTF---LEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKY------ 176
            ..::.:|..|.... .||.:   |...||:|||.:::||:|.|           .|::|      
plant   127 ADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHL-----------PFTEYLVGPIG 180

  Fly   177 --------SNVSRWYDNAKKVTPGWDE 195
                    .:||.|:|.... ...|.|
plant   181 KAHLIKDRKHVSAWWDKISS-RAAWKE 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/137 (22%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 59/223 (26%)
GST_N_Phi 2..76 CDD:239351 23/70 (33%)
GST_C_Phi 90..207 CDD:198296 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 1 0.900 OOG5_126942
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.