DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and Gstt4

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 RGDID:1591294 Length:240 Species:Rattus norvegicus

Alignment Length:224 Identity:52/225 (23%)
Similarity:95/225 (42%) Gaps:40/225 (18%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            ||....|    ||.|.:.|:..|:..:.:.::.::|.....|::::||...:|:|.|..|.:.||
  Rat     7 MDLLSAP----CRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDGKFILSES 67

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYY-------------PLFR 117
            .||..||..||....:..|.|...||.:::.:.:....:....:|..:             |..|
  Rat    68 VAILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTER 132

  Fly   118 TGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVAD-IAILSTVSTFEVSEFDFSKYSNVSR 181
            ..|. .||..|.|:.   |.:.||:.:.::.||.:::|| :|::..:.....:...|.. |.::.
  Rat   133 LDKT-LDEVNKNIKQ---FEEKFLQDKLFITGDHISLADLVALVEMMQPMGTNHNVFIS-SKLAE 192

  Fly   182 W----------------YDNAKKVTPGWD 194
            |                :|...|: |.||
  Rat   193 WRMRVELAIGSGLFWEAHDRLVKL-PSWD 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/138 (19%)
Gstt4NP_001103145.1 GstA 3..>170 CDD:223698 43/171 (25%)
GST_N_Theta 3..78 CDD:239348 23/75 (31%)
Glutathione binding. {ECO:0000250|UniProtKB:P30711} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250|UniProtKB:P30711} 66..67 1/1 (100%)
GST_C_Theta 92..216 CDD:198292 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91067349
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.