DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and Eef1g

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_080283.3 Gene:Eef1g MGIID:1914410 Length:437 Species:Mus musculus

Alignment Length:196 Identity:49/197 (25%)
Similarity:87/197 (44%) Gaps:43/197 (22%)


  Fly    41 PEFVKLNPQHTIPTLV-DNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTL 104
            |||::..|...:|... |:||.::||.|||.|:     .::.|..:.|:..|.:.|.:.|....:
Mouse    47 PEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV-----SNEELRGSTPEAAAQVVQWVSFADSDI 106

  Fly   105 YESFAKYYYPLF------RTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTV 163
            ....:.:.:|..      :.....:.|::|||   .|.|||.|:.:.::.|:::|:|||.::.|:
Mouse   107 VPPASTWVFPTLGIMHHNKQATENAKEEVKRI---LGLLDTHLKTRTFLVGERVTLADITVVCTL 168

  Fly   164 STF--EVSEFDFSK-YSNVSRWY-------------DNAKKVTPGWDENWEGLMAMKALFDARKL 212
            ...  :|.|..|.: :.|.:||:             ...|            |....|.|||:|.
Mouse   169 LWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAILGEVK------------LCEKMAQFDAKKF 221

  Fly   213 A 213
            |
Mouse   222 A 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/34 (41%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/138 (20%)
Eef1gNP_080283.3 GST_N_EF1Bgamma 4..82 CDD:239342 14/40 (35%)
GstA 5..202 CDD:223698 41/163 (25%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 27/137 (20%)
FinO_conjug_rep <211..>265 CDD:301594 6/13 (46%)
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.