DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and eef1e1

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_692806.3 Gene:eef1e1 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio

Alignment Length:183 Identity:50/184 (27%)
Similarity:83/184 (45%) Gaps:37/184 (20%)


  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLV-DNGFSIWESRAIAVYLVEKY 76
            |.:..:.:.|||:...| .:|..|::             :|.|. :||.::.....||.:|| |.
Zfish     4 RELNSLERFLGLKKANK-YSTQGGKK-------------VPVLQNNNGPALTGLVTIACHLV-KE 53

  Fly    77 GKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLDTFL 141
            .|...||.:|.::|||:.|.|...:..|...               |.|::|.|   ...|:.:|
Zfish    54 AKRPELLGDDAEQRAVVQQWLEHRITKLDNC---------------SKEEVKVI---LKDLNRYL 100

  Fly   142 EGQEYVAGDQLTVADIAILSTVS--TFEVSEFDFSKYSNVSRWYDNAKKVTPG 192
            |.:.|:||:..|:|||.:...:.  ..|::..:...|.|||||:|:.:.. ||
Zfish   101 EDKVYLAGNVFTLADILMYYGIHHIIVELAIQEKECYLNVSRWFDHIQHY-PG 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 15/62 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/108 (28%)
eef1e1XP_692806.3 GST_C_AIMP3 64..161 CDD:198338 30/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.