DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and gstr

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio

Alignment Length:214 Identity:52/215 (24%)
Similarity:93/215 (43%) Gaps:22/215 (10%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNK-KLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWE 64
            |..|:..|...|..:::..:...|:..| |||:..:.|...||...|||:..:||.......:.|
Zfish     5 MLLYWGTGSPPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEIVVNE 69

  Fly    65 SRAIAVYLVEKY-GKDDYLLPNDPKKRAVINQRLYFDMGTL----YE-SFAKYYYP-------LF 116
            |.|..:||...: .:...|:|::|.:.|::.||: |:...|    || :|..:..|       ..
Zfish    70 SFAACLYLESVFKSQGTRLIPDNPAEMALVYQRM-FETENLQQKMYEVAFYDWLVPEGERLESAL 133

  Fly   117 RTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSR 181
            :..|....|:||..|   |:|:...:| .|:||...::||:.....::.|...:....:...:..
Zfish   134 KRNKEKLIEELKLWE---GYLEKMGKG-SYLAGKNFSMADVVCFPVIAYFPRLQCPKERCPRLME 194

  Fly   182 WYDNAK---KVTPGWDENW 197
            :|:..|   .:...|...|
Zfish   195 YYEMVKDRPSIKASWPPEW 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/74 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/126 (21%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 50/207 (24%)
GST_N_family 5..78 CDD:238319 22/73 (30%)
GST_C_family 99..199 CDD:198286 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93604650
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.