DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and GstD5

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster

Alignment Length:215 Identity:170/216 (79%)
Similarity:193/216 (89%) Gaps:0/216 (0%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            |||||.|.|.|||||||||||||::||.|||||:|.:||||||||||||||||||||||||||||
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRI 130
            |||||||||||||||.|.|.||||:|::||||||||||||:||||||||||.|||||||||.|:|
  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKI 130

  Fly   131 ETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDE 195
            |::|.:|:.|||||.|||||.||||||||||||||||:.:||.:||.||:|||.|||||||||:|
  Fly   131 ESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVARWYANAKKVTPGWEE 195

  Fly   196 NWEGLMAMKALFDARKLAAK 215
            ||:|.:.:|.:||||:.|||
  Fly   196 NWKGAVELKGVFDARQAAAK 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 64/73 (88%)
GST_C_Delta_Epsilon 88..204 CDD:198287 87/116 (75%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 149/183 (81%)
GST_N_Delta_Epsilon 1..74 CDD:239343 64/73 (88%)
GST_C_Delta_Epsilon 88..204 CDD:198287 87/116 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131160856
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_126942
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.