DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and GstD4

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster

Alignment Length:215 Identity:162/216 (75%)
Similarity:185/216 (86%) Gaps:0/216 (0%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            |||||.|...|.||:||||||||||||||.|...|||.|||||:||||||||||||||||:||||
  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRI 130
            |||||||||||||||.|.||||:|||:||||||||||||::||.|||||..|||:.|:.|:.|::
  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKV 130

  Fly   131 ETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDE 195
            |.||.|||.|||||:||||.|||||||||||:||||||.|||.|||.||:|||.||||:||||||
  Fly   131 EAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWDE 195

  Fly   196 NWEGLMAMKALFDARKLAAK 215
            ||:||:.||.:::|:|.:.|
  Fly   196 NWKGLLQMKTMYEAQKASLK 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 60/73 (82%)
GST_C_Delta_Epsilon 88..204 CDD:198287 86/116 (74%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 143/183 (78%)
GST_N_Delta_Epsilon 1..74 CDD:239343 60/73 (82%)
GST_C_Delta_Epsilon 88..204 CDD:198287 86/116 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131160873
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_126942
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.