DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and GstD3

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster

Alignment Length:199 Identity:130/200 (65%)
Similarity:162/200 (81%) Gaps:0/200 (0%)


  Fly    17 MVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDY 81
            ||.||||||.|||::||::|||:.|:|:|:||||:|||||||||:|||||||.|||||||||||.
  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA 65

  Fly    82 LLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLDTFLEGQEY 146
            |.|.|.:|:|||||||||||..:|.:.|.|||..|.||:.||:||.|:::..|.||:||||||:|
  Fly    66 LYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQDY 130

  Fly   147 VAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDENWEGLMAMKALFDARK 211
            |||||.||||||||:.||.|:|..||.|||.||:||||:.||:||||:|||.|.:.:|...:.::
  Fly   131 VAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRIEEKQ 195

  Fly   212 LAAK 215
            .|||
  Fly   196 NAAK 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 43/57 (75%)
GST_C_Delta_Epsilon 88..204 CDD:198287 73/116 (63%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 43/57 (75%)
GstA 6..173 CDD:223698 114/167 (68%)
GST_C_Delta_Epsilon 72..188 CDD:198287 73/116 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131161006
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D518126at33208
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_126942
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.