DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and gstt1

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis

Alignment Length:226 Identity:57/227 (25%)
Similarity:105/227 (46%) Gaps:20/227 (9%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            :|....|    ||:|.:.|||..:..|...:...:||.|..|:.|:|....:|.|.|..|.:.||
 Frog     8 LDLLSQP----CRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFMAES 68

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYY-----PLFRTGKPGSDE 125
            .|:.:|:..|:...|:..|:|.:|.|.:::.|.:.......:.:|.::     ||. .|:....|
 Frog    69 TAMLLYMARKFKTADHWYPSDIQKCAKVDEYLAWQHTNTRPNGSKVFWVKCLTPLI-LGQEAPAE 132

  Fly   126 DLKRIETAF-----GFLDTFLEGQEYVAGDQLTVAD-IAILSTVSTFEVSEFDFSKYSNVSRWYD 184
            .:..:...|     .|.:.||..:.::|||:::||| :||:..:.........|.....::.|  
 Frog   133 KVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVADLVAIVEIMQVVAGGINVFDDRPKLAAW-- 195

  Fly   185 NAKKVTPGWDENWEGLMAMKALFDARKLAAK 215
             .|:|.....|.. .|.|.:.:.:|:|:|::
 Frog   196 -KKRVVEALGEEL-FLEAHEGILNAKKMASE 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/127 (21%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 24/75 (32%)
GST_C_Theta 92..217 CDD:198292 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.