DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and gstt1b

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio

Alignment Length:219 Identity:62/220 (28%)
Similarity:108/220 (49%) Gaps:22/220 (10%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            :|.:..|    ||:|.:.||...::.:.|.::..||.|...||.|:||....||:.|..|.:.||
Zfish     7 LDLFSQP----CRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAES 67

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKP---GSDEDL 127
            .||.:||.:|:...|:..|.|.:|||.:|:.|.:...::....||..:  |:...|   |::...
Zfish    68 VAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIW--FKILIPEVLGAEVPK 130

  Fly   128 KRIETAFG--------FLDTFLEGQEYVAGDQLTVAD-IAILSTVSTFEVSEFDFSKYSNVSRWY 183
            :::|.|..        |.|.||:.:.::.|||:::|| :||:..:..|......|.....:..|.
Zfish   131 EKMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENRPKLKAWK 195

  Fly   184 DNAKKVTPG---WDENWEGLMAMK 204
            |.. :|..|   :||..:..|:::
Zfish   196 DRV-RVAIGAKLFDEAHQATMSLR 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 26/73 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/131 (24%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 57/199 (29%)
GST_N_Theta 3..78 CDD:239348 27/75 (36%)
GST_C_Theta 91..217 CDD:198292 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126942
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.