DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and gstt2

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio

Alignment Length:173 Identity:57/174 (33%)
Similarity:85/174 (49%) Gaps:27/174 (16%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTME------GEQLKPEFVKLNPQHTIPTLVDNG 59
            :|....|    ||.|::..|      :.|:.:|:|      |||..|||.||||...:|.|.|||
Zfish    11 LDLMSQP----CRAVLIFLK------HNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNG 65

  Fly    60 FSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQ-RLYFDMGTLYESFAKYY----YPLFRTG 119
            |.:.||.||..||...|...|:..|..|:|||.::: ..:..|.|...:...::    .||. ||
Zfish    66 FVLTESDAILKYLATTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLPLM-TG 129

  Fly   120 KPGSDEDL-KRIETAFGFLD----TFLEGQEYVAGDQLTVADI 157
            :|.:...| |.:....|.||    .||:.|.::.||.:::||:
Zfish   130 QPANTAKLEKALSDLSGTLDKLENMFLKRQAFLCGDDISLADL 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 31/79 (39%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/81 (27%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 31/81 (38%)
GST_C_Theta 95..220 CDD:198292 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94428563
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.