DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and Gr59f

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster

Alignment Length:53 Identity:12/54 (22%)
Similarity:22/54 (41%) Gaps:18/54 (33%)


  Fly    60 FSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY 112
            |:||..:.:....:  ...:.|::||      :|:.          .|||:||
  Fly   170 FNIWTHKFVVYRSI--LSINSYVMPN------IISS----------ISFAQYY 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 3/14 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 6/26 (23%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.