DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and GstE3

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster

Alignment Length:199 Identity:77/200 (39%)
Similarity:121/200 (61%) Gaps:7/200 (4%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            :..|.:.|....|:|::..:||.|:.:.|::|.||.|.|||||:|:||.||:|.|.||||.:.:|
  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68

  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLF---RTGKPGSDEDL 127
            .||..|||.|||::|.|.|.|.||||:::|||::|...:..:.....:|||   :|..|.:..| 
  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARID- 132

  Fly   128 KRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEV-SEFDFSKYSNVSRWYDNAKKVTP 191
             .:|..:..|:.|||...|:|||.||:||..:::.::.|.| ...|.:||..::.|....|:: |
  Fly   133 -ALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-P 195

  Fly   192 GWDE 195
            .::|
  Fly   196 YYEE 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 34/73 (47%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/113 (32%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 75/194 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 34/73 (47%)
GST_C_Delta_Epsilon 91..208 CDD:198287 36/113 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92094168
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.