DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and GstT3

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster

Alignment Length:205 Identity:48/206 (23%)
Similarity:95/206 (46%) Gaps:14/206 (7%)


  Fly     3 FYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVK-LNPQHTIPTLVDNGFSIWESR 66
            :||.......|.:.::.:...:.....::....||.|..:|.| :|....:|.:.|||:.:.||.
  Fly    47 YYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESV 111

  Fly    67 AIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY-----YPLFRTGKPGSDED 126
            ||..||..|....::|.|.....::.:::.|.:...:|..:.|.|:     .||. ||:..|:..
  Fly   112 AILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLL-TGRTPSEAK 175

  Fly   127 LK----RIETAFGFL-DTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFS-KYSNVSRWYDN 185
            ::    ::|.....: :.:|||::::.|..||||||.....:....::::|.. ||..:..|...
  Fly   176 IETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWLKR 240

  Fly   186 AKK-VTPGWD 194
            .:: ..|.:|
  Fly   241 VRQSCNPYYD 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/72 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/120 (22%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 20/74 (27%)
GstA 47..243 CDD:223698 46/197 (23%)
GST_C_Theta 135..259 CDD:198292 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95550370
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.