DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and GstE9

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster

Alignment Length:204 Identity:73/205 (36%)
Similarity:109/205 (53%) Gaps:9/205 (4%)


  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |...:...||||:...:|:|.:.||....||...|||||:|.|.|:|..||||.||..|||.:|.
  Fly    16 RACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLVRRYA 80

  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLYES-FAKYYYPLFR---TGKPGSDEDLKRIETAFGFLD 138
            |.|.|.|.|..|||:::|||:|:.|.|::. ......|||.   |..|.|..|  .|..|:.||:
  Fly    81 KSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQID--AIYEAYDFLE 143

  Fly   139 TFLEGQEYVAGDQLTVADIAILSTVSTF-EVSEFDFSKYSNVSRWYDNAKKVTPGWDE-NWEGLM 201
            .|:..|.|:.|..:|:||.:::|:||:. .::..|..:|..::.|.|. ....|.:.. |..|..
  Fly   144 AFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDR-MAAQPNYQSLNGNGAQ 207

  Fly   202 AMKALFDAR 210
            .:..:|.::
  Fly   208 MLIDMFSSK 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 29/61 (48%)
GST_C_Delta_Epsilon 88..204 CDD:198287 37/122 (30%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 70/188 (37%)
GST_N_Delta_Epsilon 4..76 CDD:239343 28/60 (47%)
GST_C_Delta_Epsilon 92..209 CDD:198287 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92093499
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.