DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and eef1g

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio

Alignment Length:185 Identity:45/186 (24%)
Similarity:86/186 (46%) Gaps:21/186 (11%)


  Fly    41 PEFVKLNPQHTIPTLV-DNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTL 104
            |.|:...|...:|... |:||.::||.|||.||     .:|.|..:.|:..|.:.|.:.|....:
Zfish    47 PAFLGNFPLGKVPAYQGDDGFCLFESNAIAHYL-----SNDVLRGSTPQASAQVLQWVSFADSEV 106

  Fly   105 YESFAKYYYP---LFRTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTF 166
            ....:.:.:|   :.:..|..:::..:.::.....|:..|..:.::.|:::::|||.::.::...
Zfish   107 IPPASAWVFPTLGIMQFNKQATEQAKEEVKRVLAVLNQHLNTRTFLVGERISLADITVVCSLLWL 171

  Fly   167 --EVSEFDFSK-YSNVSRWYDNAK-----KVTPGWDENWEGLMAMKALFDARKLA 213
              :|.|..|.: |.||:||:....     |...|..:    |....|.|||:|.|
Zfish   172 YKQVLELAFRQPYPNVTRWFVTCVNQPQFKTVLGEVK----LCEKMAQFDAKKFA 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/34 (41%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/127 (17%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342 14/40 (35%)
maiA 5..201 CDD:273527 36/159 (23%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 22/126 (17%)
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.