DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and eef-1G

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_505800.1 Gene:eef-1G WormBaseID:WBGene00008920 Length:398 Species:Caenorhabditis elegans

Alignment Length:99 Identity:26/100 (26%)
Similarity:45/100 (45%) Gaps:14/100 (14%)


  Fly    95 QRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIET-------AFGFLDTFLEGQEYVAGDQL 152
            |.|.|..|.|..:...|..|    ....::.|.|.:|.       ....||..|..:.|:.|::|
 Worm    75 QWLQFAEGYLLPAVLGYVLP----SVSAANFDKKTVEQYKNELNGQLQVLDRVLVKKTYLVGERL 135

  Fly   153 TVADIAI-LSTVSTFE-VSEFDFSK-YSNVSRWY 183
            ::||::: |..:..|: |.:.:..| ..||:||:
 Worm   136 SLADVSVALDLLPAFQYVLDANARKSIVNVTRWF 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 26/100 (26%)
eef-1GNP_505800.1 GST_N_EF1Bgamma 3..77 CDD:239342 1/2 (50%)
GstA 4..181 CDD:223698 26/100 (26%)
GST_C_EF1Bgamma_like 71..188 CDD:198290 26/100 (26%)
EF1G 238..343 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.