DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and Gstt2

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 MGIID:106188 Length:251 Species:Mus musculus

Alignment Length:181 Identity:44/182 (24%)
Similarity:79/182 (43%) Gaps:31/182 (17%)


  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWE- 64
            :|....|.    |.|.:.||..|:....:.::.::|:.:..:|.::|..:.:|.|.|..|.:.| 
Mouse     7 LDLLSQPS----RAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTES 67

  Fly    65 ------SRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESF-----AKYYYPLFRT 118
                  |.||.:||..||...|:..|.|.:.||.:::.|.:....:..:|     .|...||...
Mouse    68 PSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGV 132

  Fly   119 GKPGSDED---------LKRIETAFGFLDTFLEGQEYVAGDQLTVADIAIL 160
            ..|....:         |:::|      |.||..:.::.|.|:|:||:..|
Mouse   133 QVPQEKVERNRDRMVLVLQQLE------DKFLRDRAFLVGQQVTLADLMSL 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 20/80 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 19/88 (22%)
Gstt2XP_011241675.1 GstA 3..217 CDD:223698 44/182 (24%)
GST_N_Theta 3..85 CDD:239348 21/82 (26%)
GST_C_Theta 98..223 CDD:198292 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95566807
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.