DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD2 and vars

Sequence 1:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio

Alignment Length:108 Identity:27/109 (25%)
Similarity:50/109 (46%) Gaps:10/109 (9%)


  Fly    85 NDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETA-----FGFLDTFLEGQ 144
            :|.|:.:.:.|.|.|....|........:||.  |..|.|:.|::...|     ...||..|..:
Zfish    76 SDKKQESQVWQWLSFAENELTPVACAVAFPLL--GIMGVDKKLQQSSRAELLRVLKALDGTLALR 138

  Fly   145 EYVAGDQLTVADIAI-LSTVSTFE--VSEFDFSKYSNVSRWYD 184
            .::.|:.:|:||.|: ::.:..|:  :...|.....||:||::
Zfish   139 TFLVGESVTLADAAVAMAALLPFKYALEPADRKSLVNVTRWFN 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 26/106 (25%)
varsNP_001298275.1 GstA <45..192 CDD:223698 27/109 (25%)
GST_C_ValRS_N 80..202 CDD:198327 25/105 (24%)
PTZ00419 291..1270 CDD:240411
ValRS_core 340..941 CDD:185677
tRNA-synt_1_2 518..643 CDD:290334
Anticodon_Ia_Val 941..1081 CDD:153416
Val_tRNA-synt_C 1203..1266 CDD:287436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.